Recombinant Bacillus subtilis Uncharacterized membrane protein yozB (yozB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Uncharacterized Membrane Protein yozB (yozB)

The recombinant Bacillus subtilis uncharacterized membrane protein yozB (Gene ID: 939655; UniProt ID: O31845) is a hypothetical protein expressed as a recombinant product for research and biotechnological applications. While its exact biological function remains undefined, its structural features and production parameters are well-documented in commercial and technical specifications. Below is a synthesis of available data on this protein.

Production and Purification

yozB is produced via recombinant DNA technology. Key parameters include:

  • Expression Hosts: E. coli (for high-yield production) or yeast (for eukaryotic-like post-translational modifications) .

  • Tagging: A His-tag is added for immobilized metal affinity chromatography (IMAC) purification.

  • Form: Supplied as liquid (PBS buffer) or lyophilized powder.

Potential Uses

  1. Immunoassays: ELISA kits targeting yozB are available for antibody detection or protein quantification .

  2. Membrane Protein Studies: Its association with B. subtilis membranes suggests utility in investigating membrane biogenesis or protein folding.

  3. Biotechnological Platforms: May serve as a scaffold for engineering membrane-bound enzymes or receptors.

Limitations

  • Functional Ambiguity: No peer-reviewed studies define its role in B. subtilis physiology.

  • Proteolytic Sensitivity: As with other B. subtilis recombinant proteins, potential degradation risks exist during secretion .

  • Lack of Structural Data: No crystallographic or NMR studies have been reported.

Comparative Analysis with Related B. subtilis Membrane Proteins

ProteinFunctionKey FeaturesReferences
yozBUncharacterized178 aa, His-tagged, membrane-associated
SpoIIIJ/YqjGMembrane protein insertionOxa1p homologs, ATP synthase assembly role
YidC (E. coli homolog)Membrane protein biogenesisComplemented by SpoIIIJ/YqjG in E. coli

Future Directions

  1. Functional Characterization: Biochemical assays (e.g., ATPase activity, membrane insertion assays) could elucidate its role.

  2. Strain Engineering: Use of protease-deficient B. subtilis strains (e.g., BINGO platform) to enhance stability .

  3. Signal Peptide Optimization: Testing alternative secretion signals to improve translocation efficiency .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yozB; BSU19140; Uncharacterized membrane protein YozB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yozB
Target Protein Sequence
MNQTENKPKNYTGIVLTLTVLINGLIAVLFFMPKLDQFSHANIHILPMLNAIFNSFTFIF LLAALIMIKQKNIKAHKRFILAAFTTTLLFLICYVTYHSIAENTLYGGEGIMRPIYFFIL ITHICLSAIIVPLALFTLIRGFSMQVERHKKIARWTMPLWLYVSLTGVIVYLMISPYY
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the yozB protein in Bacillus subtilis?

The yozB protein is an uncharacterized membrane protein from Bacillus subtilis subsp. subtilis str. 168. It is classified as a hypothetical protein with Gene ID 939655 and UniProt ID O31845. Recombinant forms are typically expressed with affinity tags such as His-tag to facilitate purification and subsequent research applications . As an uncharacterized protein, yozB represents an opportunity for novel functional discovery in Bacillus subtilis membrane biology.

What are the basic physicochemical properties of recombinant yozB protein?

Recombinant yozB protein is typically produced in expression systems such as E. coli or yeast. The protein is available in liquid or lyophilized powder formulations with the following characteristics:

PropertySpecification
Purity> 80% by SDS-PAGE
Endotoxin level< 1.0 EU per μg (LAL method)
FormLiquid or lyophilized powder
Storage bufferPBS
TagHis

These properties ensure sufficient quality for most research applications requiring recombinant yozB protein .

How should yozB protein preparations be stored for optimal stability?

For short-term storage (up to one week), recombinant yozB protein should be maintained at +4°C. For long-term preservation, storage at -20°C to -80°C is recommended to maintain protein integrity. The protein is typically provided in PBS buffer, which helps maintain its stability. Repeated freeze-thaw cycles should be avoided as they can compromise protein structure and function .

What expression systems are most effective for producing recombinant yozB protein?

Based on available methodologies, E. coli and yeast expression systems have proven effective for the production of recombinant yozB protein . When selecting an expression system, researchers should consider:

  • Post-translational modification requirements

  • Protein folding efficiency

  • Yield considerations

  • Downstream purification compatibility

For membrane proteins like yozB, specialized E. coli strains designed for membrane protein expression (such as C41/C43) may provide advantages in preventing toxicity and improving yields.

How can genome editing techniques be applied to study yozB function in Bacillus subtilis?

For functional characterization of yozB through gene knockout or modification in B. subtilis, the ssDNA-directed genome editing system has demonstrated significant efficiency. This approach involves:

  • Designing single-stranded PCR products with ~70 nucleotide homology regions flanking the target gene

  • Using lambda beta protein to promote homologous recombination

  • Employing Cre recombinase for marker excision if needed

This method allows for precise genetic manipulation without leaving significant genomic scars and can be optimized for high efficiency in B. subtilis . The lambda beta protein plays a central role by protecting ssDNA from exonucleolytic attack and promoting annealing to complementary regions, facilitating recombination through a fully single-stranded intermediate .

What are the optimal conditions for purification of recombinant His-tagged yozB protein?

For His-tagged recombinant yozB protein, a multi-step purification strategy is recommended:

  • Initial capture using immobilized metal affinity chromatography (IMAC)

  • Intermediate purification step such as ion-exchange chromatography

  • Polishing step using size exclusion chromatography

Quality control typically involves SDS-PAGE analysis to confirm purity levels exceeding 80% . For membrane proteins like yozB, the inclusion of appropriate detergents throughout the purification process is critical for maintaining protein solubility and native conformation.

How can researchers investigate protein-protein interactions involving yozB in Bacillus subtilis?

To elucidate the interaction network of yozB, several complementary approaches can be employed:

  • In vitro methods:

    • Pull-down assays using His-tagged recombinant yozB

    • Crosslinking followed by mass spectrometry

    • Surface plasmon resonance with purified protein

  • In vivo methods:

    • Bacterial two-hybrid systems adapted for B. subtilis

    • Co-immunoprecipitation from B. subtilis lysates

    • Proximity-based labeling methods (e.g., BioID)

These approaches can identify potential binding partners and provide insights into functional associations within the bacterial cell membrane environment.

What structural characterization methods are appropriate for membrane proteins like yozB?

Structural studies of membrane proteins present significant challenges. For yozB, researchers might consider:

The choice of method should be guided by specific research questions and available resources.

How can homologous recombination efficiency be optimized when working with B. subtilis genome editing?

When editing the B. subtilis genome to study yozB, researchers should consider several factors that influence homologous recombination efficiency:

  • Homology arm length - 70 nucleotides has been demonstrated as sufficient, but longer homology regions may increase efficiency

  • Protection from nucleases - B. subtilis contains the AddAB helicase-nuclease system which can degrade DNA unless Chi sites (5′-AGCGG-3′) are reached

  • ssDNA design - Using phosphorothioate modifications can protect against 5' exonuclease activity from RecJ and NrnA

  • Growth phase - Targeting cells during exponential growth phase when YhaM (a 3′-end ssDNA degrading enzyme) is repressed by LexA

Lambda beta protein has significantly higher activity compared to native B. subtilis SSAP (single-strand annealing protein), making it particularly valuable for increasing recombination efficiency in this organism .

What approaches can identify the physiological role of yozB in Bacillus subtilis?

A comprehensive approach to functional characterization includes:

  • Genetic analysis:

    • Creating knockout strains using ssDNA-directed genome editing

    • Complementation studies with wild-type and mutant variants

    • Construction of conditional depletion strains

  • Omics approaches:

    • Transcriptomic analysis comparing wild-type and ΔyozB strains

    • Comparative proteomics to identify affected pathways

    • Metabolomic profiling to detect metabolic alterations

  • Phenotypic characterization:

    • Growth curve analysis under various conditions

    • Microscopy to detect morphological changes

    • Stress resistance assays

The lambda beta/Cre recombinase system described in the literature enables efficient generation of marker-free deletion mutants, facilitating clean genetic analysis without polar effects .

How can researchers determine the subcellular localization of yozB in Bacillus subtilis?

To confirm membrane localization and determine specific distribution patterns:

  • Fluorescence microscopy approaches:

    • GFP-tagged yozB expressed at physiological levels

    • Immunofluorescence using antibodies against yozB or its tag

    • Super-resolution microscopy for detailed localization

  • Biochemical approaches:

    • Subcellular fractionation followed by western blotting

    • Protease accessibility assays to determine topology

    • Density gradient centrifugation for membrane microdomain association

These complementary approaches provide robust evidence for the protein's localization and membrane topology.

What experimental designs are effective for studying potential regulatory mechanisms of yozB expression?

To investigate regulation of yozB expression:

  • Promoter analysis:

    • Reporter gene fusions (luciferase, GFP) to the yozB promoter

    • Deletion analysis of promoter elements

    • ChIP-seq to identify transcription factor binding

  • Expression profiling:

    • qRT-PCR under various growth conditions

    • Northern blotting to detect transcript size and stability

    • RNA-seq for genome-wide expression context

  • Regulatory network mapping:

    • Genetic screens for regulators using transposon libraries

    • Two-hybrid screening for protein-DNA interactions

    • In vitro DNA-protein binding assays

The temperature-inducible promoter systems described for B. subtilis, such as the λ cI857-PRM-PR system, could be valuable tools for controlled expression studies .

What are the main challenges in working with recombinant membrane proteins like yozB and how can they be addressed?

Common challenges include:

ChallengePotential Solutions
Low expression levelsOptimize codon usage; use specialized expression strains; test inducible promoters of varying strengths
Protein aggregationScreen multiple detergents; lower induction temperature; co-express with chaperones
Improper foldingTest different fusion partners (MBP, SUMO); optimize expression kinetics with slower induction
Purification difficultiesEvaluate different affinity tags; develop custom purification protocols with stabilizing additives
Functional reconstitutionConsider proteoliposomes or nanodiscs to maintain native-like membrane environment

For functional studies, carefully consider the membrane environment to maintain native-like conditions, potentially requiring reconstitution into liposomes or nanodiscs.

How can researchers distinguish between potential artifacts and genuine results when characterizing novel membrane proteins?

To ensure robust characterization of yozB:

  • Multiple validation approaches:

    • Use complementary techniques to verify findings

    • Include appropriate positive and negative controls

    • Perform reciprocal experiments (e.g., pull-downs from both directions)

  • Critical controls:

    • Compare with ΔyozB strain as negative control

    • Use unrelated membrane proteins as specificity controls

    • Perform dose-response relationships where applicable

  • Replication and statistical analysis:

    • Conduct biological replicates from independent cultures

    • Apply appropriate statistical tests

    • Consider blind analysis where experimenter bias could influence results

These practices help distinguish genuine biological phenomena from technical artifacts.

What quality control measures should be applied to recombinant yozB preparations for advanced applications?

For applications requiring high-quality preparations:

  • Homogeneity assessment:

    • Size exclusion chromatography profiles

    • Dynamic light scattering for aggregation detection

    • Native PAGE analysis

  • Functional verification:

    • Binding assays if ligands are known

    • Stability assessments under experimental conditions

    • Activity assays if enzymatic function is established

  • Structural integrity:

    • Circular dichroism to confirm secondary structure

    • Limited proteolysis to verify folding

    • Mass spectrometry to confirm primary sequence and modifications

The specified purity of >80% by SDS-PAGE represents a minimum threshold for most applications, but higher purity (>95%) may be required for structural biology or other advanced applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.