Recombinant Bacillus subtilis Uncharacterized membrane protein yrrS (yrrS)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bacillus subtilis Uncharacterized membrane protein yrrS (yrrS) is a protein produced using an in vitro E. coli expression system . It is often available as a lyophilized powder and is shipped with ice packs. Synonyms for yrrS include BSU27300 and Uncharacterized membrane protein YrrS.

Properties

  • Source: Produced in an in vitro E. coli expression system .

  • Form: Typically supplied as a lyophilized powder.

  • Storage: Store at -20°C/-80°C upon receipt, avoiding repeated freeze-thaw cycles. Aliquoting is recommended for multiple uses.

  • Reconstitution: Centrifuge the vial briefly before opening. Reconstitute in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C is recommended.

  • Shelf Life: Liquid formulations typically have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.

  • Buffer Before Lyophilization: Tris/PBS-based buffer with 6% Trehalose.

  • Expression Region: 1-233.

  • Protein Length: Full length protein.

  • Species: Bacillus subtilis (strain 168).

  • Target Names: yrrS.

  • Uniprot No.: O32031.

  • Subcellular Location: Cell membrane; Single-pass membrane protein.

Function and Research Applications

The yrrS protein is an uncharacterized membrane protein from Bacillus subtilis . Bacillus subtilis is a Gram-positive bacterium known for its high stress resistance, non-toxicity, and ability to secrete proteins, making it a promising microbial expression system in bioengineering . A genome-reduced strain of Bacillus subtilis, IIG-Bs-27-39, has shown superior secretion of staphylococcal antigens and higher specific growth rates and biomass, indicating its potential in producing heterologous secretory proteins .

While yrrS itself is uncharacterized, recombinant Bacillus subtilis strains have been engineered to produce various proteins for different applications. For example, recombinant Bacillus subtilis strains expressing rabies virus G protein have been developed as oral vaccine candidates, demonstrating significant immunogenicity in mice . Additionally, Bacillus subtilis has been engineered to produce spores with surface-expressed SARS-CoV-2 spike proteins, suggesting its use in vaccine-like supplements against respiratory infections .

Database Links

  • KEGG: bsu:BSU27300

  • STRING: 224308.Bsubs1_010100014916

Availability

Recombinant Bacillus subtilis Uncharacterized membrane protein yrrS (yrrS) is available for purchase from several suppliers . The protein is typically produced in an in vitro E. coli expression system and shipped with ice packs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yrrS; BSU27300; Uncharacterized membrane protein YrrS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yrrS
Target Protein Sequence
MSNNQSRYENRDKRRKANLVLNILIAIVSILIVVVAANLFINSPSSKDVSKDSETAQKQE SPASGKTEKKSDEDIKDSKKDTSDSEKDSEKSSDSDSKKDDSSSKKDDSDSDSSSDSAGD GLKDAKVTEGGSSSDVEKTYENPDWKAVGTEQTGEHAATYDSSSQDWAEMLKAISYATGV STDNMTVLWLGNNGSPQDAKGKILDKATGNKYQVTITWVDEKGWKPTKVEKLK
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the yrrS membrane protein in Bacillus subtilis?

YrrS is an uncharacterized membrane protein in Bacillus subtilis, a Gram-positive bacterium widely used as a model organism in molecular biology and biotechnology. Like many membrane proteins, yrrS is likely embedded in the lipid bilayer of B. subtilis and may serve important functions related to cellular processes. As membrane proteins constitute approximately 50% of a typical plasma membrane's mass, uncharacterized proteins like yrrS represent significant opportunities for expanding our understanding of bacterial membrane biology .

Why is Bacillus subtilis an important model organism for studying membrane proteins?

Bacillus subtilis serves as an exceptional model organism for studying membrane proteins due to its well-characterized genome, ease of genetic manipulation, and robust growth characteristics. Often referred to as a "Swiss Army Knife in Science and Biotechnology," B. subtilis has contributed significantly to our understanding of bacterial cytoskeleton and membrane dynamics . The rod-shaped bacilli exhibit distinctive peptidoglycan (PG) synthesis at the lateral side via a multiprotein complex called the elongasome, which includes the bacterial actin-homologue MreB . This organized membrane architecture makes B. subtilis ideal for studying novel membrane proteins like yrrS and their potential interactions with established membrane systems.

How do you distinguish between transmembrane and membrane-associated proteins when characterizing yrrS?

Distinguishing between transmembrane and membrane-associated proteins requires a combination of bioinformatic prediction and experimental validation. For transmembrane proteins, hydrophobic segments span the entire lipid bilayer, while peripheral membrane proteins may be attached to the membrane through interactions with other proteins or through covalent linkages to lipids .

For yrrS characterization, start with computational analysis using transmembrane prediction algorithms to identify potential membrane-spanning domains. Experimentally, techniques such as protease protection assays can determine which regions of the protein are accessible from different sides of the membrane. Membrane fractionation followed by Western blotting can confirm membrane localization, while techniques like alkaline extraction can distinguish between integral and peripheral membrane proteins. Green fluorescent protein (GFP) fusion constructs can also visualize subcellular localization, similar to approaches used with other B. subtilis membrane proteins such as MreB-GFP fusions that helped establish the bacterial cytoskeleton concept .

What biosafety considerations should be addressed when working with recombinant B. subtilis expressing the yrrS protein?

  • Institutional approval: Submit a complete recombinant DNA protocol to your Institutional Biosafety Committee (IBC) before initiating any experiments .

  • NIH Guidelines compliance: Ensure your research adheres to the NIH Guidelines for Research Involving Recombinant and Synthetic DNA Molecules .

  • Aerosol control: Implement standard approved protocols, personal protective equipment (PPE), and engineering controls when conducting procedures that can generate aerosols containing recombinant agents .

  • Waste management: Follow institutional protocols for disposing of liquid waste, stocks, and disposable labware contaminated with biological hazards .

  • Personnel training: Ensure all laboratory personnel are properly trained in potential biohazards, biosafety practices, techniques, and emergency procedures .

This systematic approach ensures compliance with regulatory requirements while maintaining a safe working environment for all laboratory personnel.

What are the most effective expression systems for producing recombinant yrrS protein in sufficient quantities for structural studies?

For producing recombinant yrrS membrane protein in quantities suitable for structural studies, several expression systems can be considered, each with distinct advantages:

  • Homologous expression in B. subtilis: This approach maintains the native cellular environment for proper folding and post-translational modifications. Utilize strong inducible promoters like Pxyl or Pspac, coupled with optimization of growth conditions including temperature, media composition, and induction timing.

  • E. coli-based expression systems: Despite being heterologous, E. coli offers high yield potential. For membrane proteins like yrrS, specialized E. coli strains (C41, C43, or Lemo21) designed for membrane protein expression may improve results. The pET expression system with T7 promoter under IPTG control offers tight regulation and high expression levels.

  • Cell-free expression systems: These bypass the toxicity often associated with membrane protein overexpression in living cells and allow direct incorporation into nanodiscs or liposomes.

When designing vectors, include fusion tags (His6, MBP, or SUMO) to facilitate purification and improve solubility. For crystallography or cryo-EM studies, thermal stability is crucial, so consider engineering constructs with removed flexible regions based on bioinformatic predictions.

The purification protocol should include careful membrane solubilization using detergents like DDM, LMNG, or digitonin, followed by affinity chromatography and size exclusion chromatography. Throughout purification, protein stability should be monitored using techniques like size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS).

How can CRISPR/Cas9 genome editing be optimized for creating yrrS knockout or tagged variants in B. subtilis?

Optimizing CRISPR/Cas9 genome editing for yrrS manipulation in B. subtilis requires a systematic approach:

  • sgRNA design: Select target sequences within the yrrS gene with minimal off-target effects using algorithms that account for B. subtilis genome specificity. Include a proper PAM sequence (typically 5'-NGG-3' for SpCas9) and design sgRNAs with high on-target activity scores.

  • Delivery system optimization: For B. subtilis, non-replicating plasmids that express both Cas9 and sgRNA under appropriate promoters work effectively. Consider using the strong, inducible Pxyl promoter for Cas9 expression and a constitutive promoter for sgRNA.

  • Homology-directed repair template design:

    • For knockouts: Design homology arms of 500-1000 bp flanking the yrrS gene

    • For tagging: Include the tag sequence (e.g., His, FLAG, or fluorescent protein) with a flexible linker while maintaining the reading frame

  • Transformation protocol enhancement:

    • Use competent cells prepared at the peak of competence development

    • Optimize DNA concentration ratios between Cas9-sgRNA plasmid and repair template

    • Consider using a two-plasmid system if toxicity is observed

  • Screening strategy:

    • Design PCR primers outside the homology regions to verify successful editing

    • For tagged variants, confirm protein expression by Western blotting

    • Sequence the entire modified region to ensure no unintended mutations

  • Potential challenges and solutions:

    • Low editing efficiency: Try different sgRNAs or modify the Cas9 expression level

    • Off-target effects: Perform whole-genome sequencing of edited strains

    • Growth defects: Use inducible systems to control the timing of editing

This comprehensive approach ensures efficient generation of yrrS variants while minimizing potential issues associated with CRISPR/Cas9 genome editing in B. subtilis.

What phenotypic assays are most informative for determining the cellular function of yrrS in B. subtilis?

To determine the cellular function of the uncharacterized yrrS membrane protein in B. subtilis, a comprehensive set of phenotypic assays should be employed:

  • Growth kinetics analysis:

    • Compare growth rates of wild-type and yrrS knockout strains under various conditions (different temperatures, media compositions, pH levels, osmotic stresses)

    • Perform competition assays between wild-type and mutant strains to detect subtle fitness differences

  • Membrane integrity assays:

    • Membrane permeability tests using propidium iodide or SYTOX Green

    • Sensitivity to membrane-targeting antibiotics and detergents

    • Membrane potential measurements using voltage-sensitive dyes

  • Cell morphology examination:

    • Phase contrast and fluorescence microscopy to assess cell shape, size, and division patterns

    • Transmission electron microscopy to examine envelope ultrastructure

    • Fluorescent D-amino acid labeling to visualize peptidoglycan synthesis patterns, particularly relevant given B. subtilis' well-characterized elongasome complex and MreB cytoskeleton

  • Protein localization studies:

    • Fluorescently tagged yrrS to determine subcellular localization

    • Co-localization with known membrane protein complexes, particularly those involved in cell elongation and division

    • Time-lapse microscopy to observe dynamic behaviors, similar to studies that revealed MreB forms dynamic patches requiring active peptidoglycan synthesis

  • Stress response assessments:

    • Oxidative stress resistance (H₂O₂, paraquat challenges)

    • Heat and cold shock survival

    • Resistance to cell wall-targeting antibiotics

  • Biofilm formation capacity:

    • Crystal violet staining of surface-attached biomass

    • Pellicle formation at air-liquid interfaces

    • Architectural analysis using confocal microscopy

  • Sporulation efficiency measurement:

    • Quantification of heat-resistant spores

    • Microscopic examination of asymmetric division and engulfment

This multifaceted approach will generate a comprehensive phenotypic profile, providing insights into yrrS function and its potential role in membrane organization, cell envelope biogenesis, or stress responses.

How can protein-protein interaction studies be designed to identify yrrS binding partners within the membrane?

Identifying protein-protein interactions for membrane proteins like yrrS requires specialized approaches that preserve the native membrane environment. A comprehensive strategy includes:

  • In vivo crosslinking coupled with mass spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers like formaldehyde or DSP

    • Analyze crosslinked complexes by LC-MS/MS after digestion

    • Map interaction sites at the residue level

    • This approach is particularly valuable for capturing transient interactions within dynamic complexes similar to the elongasome in B. subtilis

  • Bacterial two-hybrid systems adapted for membrane proteins:

    • Use split-ubiquitin or BACTH (Bacterial Adenylate Cyclase Two-Hybrid) systems specifically designed for membrane protein interactions

    • Screen against a B. subtilis genomic library to identify potential interactors

    • Validate positive hits with reciprocal experiments

  • Co-immunoprecipitation with membrane solubilization:

    • Express epitope-tagged yrrS in B. subtilis

    • Carefully solubilize membranes with mild detergents (digitonin, DDM)

    • Immunoprecipitate complexes and identify components by mass spectrometry

    • Include appropriate controls to distinguish specific from non-specific interactions

  • Proximity labeling techniques:

    • Fuse yrrS to enzymes like BioID or APEX2

    • These enzymes biotinylate proximal proteins when activated

    • Identify biotinylated proteins through streptavidin pulldown and mass spectrometry

    • This approach can capture both stable and transient interactions in the native cellular context

  • Fluorescence-based interaction assays:

    • Förster Resonance Energy Transfer (FRET) between fluorescently labeled proteins

    • Bimolecular Fluorescence Complementation (BiFC) to visualize interactions in vivo

    • Fluorescence Recovery After Photobleaching (FRAP) to assess dynamics of protein complexes

  • Data analysis and network construction:

    • Filter hits based on enrichment over controls and reproducibility

    • Validate key interactions through reciprocal pulldowns and functional assays

    • Construct interaction networks incorporating known membrane protein complexes

    • Consider potential associations with the elongasome complex or MreB filaments, given their importance in B. subtilis membrane organization

This integrated approach maximizes the chance of identifying physiologically relevant interaction partners while minimizing artifacts associated with membrane protein analysis.

What approaches can be used to determine if yrrS is involved in the bacterial elongasome complex?

To investigate yrrS involvement in the bacterial elongasome complex, a multifaceted approach combining genetic, biochemical, and microscopy techniques should be employed:

  • Co-localization microscopy studies:

    • Create fluorescent protein fusions to yrrS and known elongasome components (particularly MreB)

    • Perform dual-color fluorescence microscopy to assess spatial overlap

    • Use super-resolution techniques (PALM/STORM, SIM) for detailed co-localization analysis

    • Analyze the dynamic behavior of yrrS in relation to MreB patches, which show distinctive movements associated with active peptidoglycan synthesis

  • Genetic interaction analysis:

    • Construct double mutants of yrrS with known elongasome components

    • Analyze synthetic phenotypes (growth defects, morphological changes)

    • Perform suppressor screens to identify compensatory mutations

    • Evaluate the impact of yrrS deletion on MreB filament formation and dynamics

  • Biochemical complex isolation:

    • Perform co-immunoprecipitation experiments targeting known elongasome components

    • Use chemical crosslinking to stabilize transient interactions

    • Analyze complexes by blue native PAGE to preserve native interactions

    • Employ quantitative proteomics to determine stoichiometry within complexes

  • Functional assays for peptidoglycan synthesis:

    • Monitor incorporation of fluorescent D-amino acids to track active PG synthesis sites

    • Compare patterns in wild-type versus yrrS mutant strains

    • Assess sensitivity to specific cell wall antibiotics that target different steps in PG synthesis

    • Measure peptidoglycan composition and crosslinking by HPLC analysis

  • Protein-protein interaction domain mapping:

    • Create truncated versions of yrrS to identify regions required for potential elongasome interactions

    • Perform bacterial two-hybrid assays with specific domains of elongasome components

    • Use site-directed mutagenesis to identify critical residues for interactions

  • Impact on cell wall architecture:

    • Electron cryotomography to visualize potential changes in cell wall ultrastructure

    • Atomic force microscopy to measure cell wall mechanical properties

    • Assess changes in cell morphology during different growth phases and stress conditions

This comprehensive approach will provide multiple lines of evidence regarding the potential involvement of yrrS in the elongasome complex, which is central to B. subtilis cell wall synthesis and maintenance .

What are the current challenges in determining the three-dimensional structure of yrrS membrane protein?

Determining the three-dimensional structure of the yrrS membrane protein presents several significant challenges that are common to membrane protein structural biology:

  • Expression and purification limitations:

    • Overexpression often leads to toxicity or misfolding

    • Extraction from membranes requires detergents that can destabilize native structure

    • Maintaining protein stability throughout purification is difficult

    • Achieving sufficient protein quantities for structural studies requires optimization of expression systems and purification protocols

  • Crystallization obstacles:

    • Detergent micelles create unfavorable packing interactions in crystals

    • Membrane proteins often have limited hydrophilic surfaces for crystal contacts

    • Conformational heterogeneity reduces crystallization propensity

    • Lipid-protein interactions important for stability are difficult to maintain

  • Cryo-EM specific challenges:

    • Small membrane proteins (<100 kDa) are difficult to visualize due to contrast limitations

    • Preferred orientation in vitreous ice can limit 3D reconstruction quality

    • Detergent belts reduce signal-to-noise ratio and complicate particle picking and alignment

  • NMR spectroscopy barriers:

    • Size limitations affect spectral quality

    • Detergent micelles increase effective molecular weight

    • Signal overlap in transmembrane regions due to similar chemical environments

    • Challenging assignment of resonances in hydrophobic regions

  • Structural dynamics considerations:

    • Membrane proteins often exist in multiple conformational states

    • Capturing physiologically relevant conformations requires appropriate ligands or conditions

    • Different lipid environments can alter protein structure and dynamics

  • Computational prediction limitations:

    • Homology modeling is challenging for uncharacterized proteins with low sequence similarity to known structures

    • Ab initio predictions, even with advanced tools like AlphaFold2, remain less accurate for membrane proteins

To address these challenges, integrative structural biology approaches that combine multiple techniques (X-ray crystallography, cryo-EM, NMR, crosslinking mass spectrometry, EPR spectroscopy) with computational modeling are increasingly employed for membrane proteins like yrrS.

How can molecular dynamics simulations help understand yrrS structure-function relationships within the bacterial membrane?

Molecular dynamics (MD) simulations provide powerful insights into yrrS structure-function relationships within the bacterial membrane through several key applications:

  • Conformational dynamics exploration:

    • Reveal structural fluctuations and conformational states not captured by static experimental structures

    • Identify potentially functional flexible regions and hinge points

    • Sample rare conformations that might be important for function

    • Map the energy landscape to understand thermodynamic stability of different conformations

  • Lipid-protein interaction characterization:

    • Identify specific lipid binding sites on the yrrS surface

    • Determine how different lipid compositions affect protein structure and dynamics

    • Analyze potential changes in membrane thickness or curvature induced by yrrS

    • This is particularly relevant given the specialized membrane domains required for functions like peptidoglycan synthesis in B. subtilis

  • Water and ion permeation analysis:

    • If yrrS functions as a channel or transporter, MD can reveal permeation pathways

    • Calculate potential of mean force profiles for substrate transport

    • Identify key residues forming gates or selectivity filters

    • Estimate conductance rates through enhanced sampling techniques

  • Mutation effect prediction:

    • Simulate site-directed mutations to predict functional consequences

    • Identify stabilizing mutations for experimental structure determination

    • Understand evolutionary conservation in the context of structural dynamics

    • Guide the design of experimental mutations for functional studies

  • Integration with experimental data:

    • Refine low-resolution experimental structures through MD-based refinement

    • Interpret spectroscopic data in the context of dynamic ensembles

    • Validate homology models or AI-predicted structures in membrane environments

    • Use crosslinking data to guide modeling of protein-protein interactions

  • Practical implementation considerations:

    • Start with appropriate membrane compositions mimicking B. subtilis membranes

    • Use enhanced sampling techniques (metadynamics, replica exchange) to overcome energy barriers

    • Employ polarizable force fields for accurate electrostatic interactions

    • Consider multiscale approaches combining atomistic and coarse-grained simulations for extended timescales

These MD applications provide a dynamic view of yrrS in its native environment, complementing experimental approaches and generating testable hypotheses about function, similar to how computational approaches have enhanced our understanding of other bacterial membrane proteins .

What spectroscopic techniques are most appropriate for analyzing secondary structure elements of yrrS?

Several spectroscopic techniques are particularly valuable for analyzing the secondary structure elements of membrane proteins like yrrS, each with specific advantages:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-250 nm) provides quantitative estimates of α-helical, β-sheet, and random coil content

    • Requires relatively small amounts of protein (0.1-0.5 mg/ml)

    • Can monitor thermal stability and conformational changes upon ligand binding

    • Works well in detergent solutions common for membrane protein preparation

    • Practical approach: Compare spectra in different detergents to optimize conditions maintaining native structure

  • Fourier Transform Infrared (FTIR) Spectroscopy:

    • Particularly useful for membrane proteins due to sensitivity to β-sheet structures

    • The amide I band (1600-1700 cm⁻¹) provides detailed secondary structure information

    • Can be performed in various environments including detergents, liposomes, or native membranes

    • Less affected by solution turbidity than CD, allowing measurements in lipid environments

    • Practical approach: Use hydrogen/deuterium exchange to distinguish surface-exposed from buried structural elements

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Chemical shifts provide residue-specific secondary structure information

    • ¹⁵N-HSQC experiments can serve as structural fingerprints

    • Solid-state NMR applicable to membrane-embedded proteins

    • Can detect dynamic processes on various timescales

    • Practical approach: For larger proteins like yrrS, selective labeling strategies can overcome size limitations

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Site-directed spin labeling combined with EPR provides structural constraints

    • Particularly valuable for determining membrane protein topology

    • Accessibility measurements distinguish water-exposed from lipid-exposed residues

    • Distance measurements between labels constrain tertiary structure

    • Practical approach: Create a library of single-cysteine mutants for comprehensive structural mapping

  • Raman Spectroscopy:

    • Complementary to FTIR with less interference from water

    • Provides information on side chain orientations and hydrogen bonding

    • Resonance Raman can selectively enhance signals from specific chromophores

    • Can be performed in native-like membrane environments

    • Practical approach: Use UV resonance Raman to enhance signals from aromatic residues at transmembrane boundaries

  • Data integration and analysis:

    • Combine multiple techniques for cross-validation

    • Use reference datasets of known membrane protein structures for accurate interpretation

    • Apply deconvolution algorithms for quantitative secondary structure estimation

    • Integrate with computational predictions and homology models

This multi-technique approach provides comprehensive secondary structure information while overcoming the limitations of individual methods, critical for understanding membrane proteins like yrrS where traditional structural biology techniques face significant challenges .

How do you identify and analyze structural homologs of yrrS across bacterial species?

Identifying and analyzing structural homologs of the uncharacterized yrrS membrane protein across bacterial species requires a systematic approach that integrates sequence-based and structure-based methods:

  • Sequence-based homology detection:

    • Begin with standard BLAST searches against sequence databases

    • Employ position-specific iterative BLAST (PSI-BLAST) for detecting remote homologs

    • Use hidden Markov model (HMM) based tools like HMMER against Pfam and InterPro databases

    • Search specialized membrane protein databases like TransportDB and TCDB

    • Create sequence similarity networks to visualize relationships between homologs

  • Structure-based homology prediction:

    • Use threading algorithms (I-TASSER, Phyre2) to identify structural templates

    • Apply AlphaFold2 or RoseTTAFold to predict the structure of yrrS and potential homologs

    • Compare predicted structures using structural alignment tools (DALI, TM-align)

    • Identify conserved structural motifs even when sequence similarity is low

    • This approach is particularly valuable for membrane proteins where sequence conservation may be limited to functional regions

  • Transmembrane topology analysis:

    • Compare predicted transmembrane domain organization across potential homologs

    • Use consensus prediction from multiple tools (TMHMM, Phobius, TOPCONS)

    • Identify conserved loop regions that may have functional significance

    • Map conservation onto topological models to identify functional hotspots

  • Genomic context analysis:

    • Examine gene neighborhood conservation across different bacteria

    • Identify consistently co-occurring genes that suggest functional associations

    • Look for operonic structures that indicate functional units

    • Consider synteny analyses to track evolutionary rearrangements

  • Phylogenetic analysis:

    • Construct phylogenetic trees of identified homologs

    • Map the distribution of yrrS homologs onto the bacterial tree of life

    • Analyze patterns of gene gain/loss across lineages

    • Identify potential horizontal gene transfer events

  • Functional domain mapping:

    • Identify conserved domains and motifs across homologs

    • Map known or predicted binding sites and catalytic residues

    • Compare with characterized membrane proteins to infer potential functions

    • Consider potential relationships to membrane protein complexes like the elongasome that are central to bacterial cell morphology

This comprehensive approach leverages both sequence and structural information to identify functionally relevant homologs across bacterial species, providing evolutionary context for understanding yrrS function.

What can sequence conservation patterns tell us about the functional domains within yrrS?

Sequence conservation patterns provide crucial insights into functional domains within the uncharacterized yrrS membrane protein through several analytical approaches:

  • Conservation scoring across homologs:

    • Calculate position-specific conservation scores using methods like Jensen-Shannon divergence

    • Identify highly conserved residues that may be critical for structure or function

    • Map conservation onto predicted secondary structure elements

    • Visualize conservation patterns using heat maps or 3D structural models

    • This approach parallels methods used to identify functional regions in other membrane proteins

  • Evolutionary rate analysis:

    • Calculate site-specific evolutionary rates (dN/dS ratios)

    • Identify sites under purifying selection (indicative of functional constraints)

    • Detect sites under positive selection (potentially involved in adaptation)

    • Compare evolutionary rates between transmembrane and loop regions

  • Coevolution network identification:

    • Detect coevolving residue pairs using methods like direct coupling analysis

    • Identify networks of coevolving residues that may form functional units

    • Distinguish between structure-maintaining and function-specific coevolution

    • Use coevolution data as constraints for structural modeling

  • Sequence motif detection:

    • Search for known functional motifs associated with membrane protein functions

    • Use motif discovery algorithms to identify novel conserved patterns

    • Compare identified motifs with databases like PROSITE or ELM

    • Assess the conservation of these motifs across bacterial phyla

  • Domain architecture comparison:

    • Identify conserved domain boundaries across homologs

    • Compare with known membrane protein families for functional insights

    • Detect potential domain fusion or fission events during evolution

    • Analyze the conservation of specific loops or transmembrane segments

  • Functional inference from conservation patterns:

    • Highly conserved extracellular loops may indicate substrate binding or recognition sites

    • Conserved charged residues within transmembrane regions often have functional roles

    • Conserved glycine or proline residues may indicate structurally important kinks or flexion points

    • Conservation patterns in predicted amphipathic helices may suggest membrane-association mechanisms

  • Practical application to experimental design:

    • Target conserved residues for site-directed mutagenesis

    • Design truncation constructs based on predicted domain boundaries

    • Focus structural studies on highly conserved regions

    • Design chimeric proteins to test domain-specific functions

This multifaceted analysis of sequence conservation provides a foundation for generating testable hypotheses about yrrS functional domains and directing experimental efforts toward the most promising structural and functional features.

How might horizontal gene transfer have influenced the evolution and distribution of yrrS across bacterial species?

Horizontal gene transfer (HGT) potentially plays a significant role in the evolution and distribution of membrane proteins like yrrS across bacterial species. A comprehensive analysis of this phenomenon reveals:

  • Genomic signatures of HGT events:

    • Anomalous GC content or codon usage bias compared to the host genome

    • Presence of mobile genetic element remnants (transposases, integrases) near the yrrS gene

    • Inconsistent phylogenetic distribution patterns compared to species phylogeny

    • Synteny breaks or gene order discontinuities across closely related species

    • These genomic signatures can indicate whether yrrS has been subject to HGT events

  • Comparative phylogenetic analysis:

    • Construction of yrrS gene trees versus species trees to identify incongruences

    • Identification of unexpected clustering patterns across distant bacterial lineages

    • Detection of accelerated evolution rates following potential transfer events

    • Analysis of sequence divergence patterns to date potential HGT events

    • This approach can reveal whether yrrS distribution follows vertical inheritance or shows evidence of horizontal acquisition

  • Functional adaptation following HGT:

    • Analysis of selection pressures (dN/dS ratios) before and after potential transfer events

    • Identification of lineage-specific modifications that may indicate functional adaptation

    • Comparison of protein characteristics in donor and recipient lineages

    • Correlation with ecological niches or lifestyles of recipient organisms

    • These analyses can reveal how yrrS may have been functionally repurposed following transfer

  • Membrane compatibility considerations:

    • Assessment of membrane protein compatibility with recipient cell membranes

    • Analysis of hydrophobic matching between transmembrane segments and host lipid bilayers

    • Evaluation of potential interactions with existing membrane protein complexes

    • This is particularly relevant for membrane proteins that must integrate into complex structures like the elongasome in B. subtilis

  • Ecological drivers of yrrS HGT:

    • Correlation between yrrS transfer patterns and ecological niches

    • Association with specific bacterial lifestyles (free-living, host-associated, etc.)

    • Potential co-transfer with functionally related genes

    • Analysis of whether yrrS transfer confers selective advantages in specific environments

  • Practical implications for research:

    • Design of degenerate primers targeting conserved regions for detecting divergent homologs

    • Selection of diverse model organisms for comparative functional studies

    • Consideration of host-specific factors when expressing yrrS in heterologous systems

    • Development of evolutionary models to predict potential functions in different bacterial contexts

This multifaceted analysis of HGT's role in yrrS evolution provides a framework for understanding its distribution and functional diversity across bacterial species, offering valuable insights for both evolutionary studies and applied research.

What are the most common technical challenges when expressing and purifying yrrS for structural studies, and how can they be overcome?

Expressing and purifying membrane proteins like yrrS for structural studies presents several technical challenges that require specific strategies to overcome:

  • Expression toxicity and inclusion body formation:

    • Challenge: Overexpression often leads to cell toxicity or inclusion body formation

    • Solutions:

      • Use tightly controlled inducible promoters with optimized induction conditions (temperature, inducer concentration, timing)

      • Consider specialized expression hosts (C41/C43 E. coli, B. subtilis protease-deficient strains)

      • Co-express with chaperones to improve folding

      • Use fusion partners (MBP, SUMO) to enhance solubility

      • For toxic proteins, consider cell-free expression systems that bypass cellular toxicity issues

  • Membrane extraction and solubilization:

    • Challenge: Efficient extraction without denaturing the protein

    • Solutions:

      • Screen multiple detergents (DDM, LMNG, digitonin) at various concentrations

      • Use detergent mixtures for improved extraction efficiency

      • Consider native nanodiscs or SMALPs (styrene maleic acid lipid particles) for extraction with native lipids

      • Optimize extraction conditions (temperature, time, buffer composition)

      • Add specific lipids that may stabilize the protein during extraction

  • Protein instability during purification:

    • Challenge: Membrane proteins often destabilize during purification

    • Solutions:

      • Include stabilizing additives (glycerol, specific lipids, ligands)

      • Optimize buffer conditions (pH, ionic strength, specific ions)

      • Minimize exposure to room temperature

      • Use thermostability assays (CPM, nanoDSF) to monitor stability during purification

      • Consider GFP fusion for real-time stability monitoring

      • Apply conformational stabilization through antibody fragments or nanobodies

  • Low yield and purity issues:

    • Challenge: Obtaining sufficient quantities of pure protein

    • Solutions:

      • Optimize construct design by removing flexible regions

      • Use tandem affinity tags for improved purity

      • Scale up expression using bioreactors with controlled aeration

      • Implement high-throughput screening to identify optimal conditions

      • Consider refolding approaches for proteins that express well as inclusion bodies

      • Use fluorescence-detection size-exclusion chromatography (FSEC) to optimize purification conditions

  • Lipid requirements for function and stability:

    • Challenge: Maintaining native lipid interactions critical for structure

    • Solutions:

      • Add specific lipids during purification based on bacterial membrane composition

      • Consider reconstitution into liposomes or nanodiscs with defined lipid compositions

      • Use mild solubilization techniques that preserve annular lipids

      • Monitor function after each purification step to ensure activity retention

  • Heterogeneity and aggregation:

    • Challenge: Purified samples often show heterogeneity or aggregation

    • Solutions:

      • Employ analytical techniques (SEC-MALS, DLS, analytical ultracentrifugation) to assess sample quality

      • Use gradient ultracentrifugation to separate different oligomeric states

      • Apply GFP-based techniques to distinguish properly folded from aggregated protein

      • Consider protein engineering to remove aggregation-prone regions

      • Use orthogonal purification steps to select for functional conformations

These strategies address the specific challenges of membrane protein preparation, increasing the likelihood of obtaining stable, homogeneous yrrS samples suitable for structural and functional studies .

How do you reconcile contradictory results between computational predictions and experimental data for yrrS function?

Reconciling contradictory results between computational predictions and experimental data for yrrS function requires a systematic approach to identify sources of discrepancy and integrate diverse lines of evidence:

  • Critical assessment of computational predictions:

    • Evaluate the confidence scores and limitations of prediction algorithms

    • Consider whether the algorithms were trained on datasets representing similar membrane proteins

    • Assess if the models account for the unique membrane environment

    • Check for consistency across multiple independent prediction methods

    • Examine whether predictions account for potential protein-protein interactions within membrane complexes like the elongasome

  • Rigorous evaluation of experimental approaches:

    • Review experimental protocols for potential artifacts or limitations

    • Consider if experimental conditions adequately mimic the native environment

    • Assess statistical robustness and reproducibility of experimental results

    • Evaluate whether the experimental system (e.g., heterologous expression) may alter protein behavior

    • Determine if experiments inadvertently disrupted important protein-protein interactions

  • Targeted validation experiments:

    • Design experiments specifically addressing the points of contradiction

    • Use orthogonal experimental techniques to test the same hypothesis

    • Create structure-guided mutations to test specific aspects of computational models

    • Develop functional assays with appropriate positive and negative controls

    • Consider in vivo approaches that maintain the native context of the membrane protein

  • Integration of multiple data types:

    • Combine low-resolution experimental data with computational models

    • Use experimental constraints to refine computational predictions

    • Apply Bayesian approaches to weight different evidence sources

    • Develop integrated models that reconcile contradictory results

    • Consider ensemble models that account for protein dynamics and multiple conformational states

  • Context-dependent function evaluation:

    • Assess whether contradictions arise from different cellular or experimental contexts

    • Investigate if yrrS has multiple functions depending on cellular conditions

    • Consider potential moonlighting roles in different protein complexes

    • Evaluate whether post-translational modifications affect function

    • Examine if interactions with specific lipids or other membrane components influence function

  • Collaborative approach to resolution:

    • Engage both computational and experimental experts to interpret discrepancies

    • Consider blind prediction challenges followed by experimental validation

    • Iteratively refine both computational models and experimental approaches

    • Develop new computational methods that incorporate experimental uncertainties

    • Create frameworks for formal integration of complementary approaches

This systematic approach acknowledges that contradictions often represent opportunities for deeper understanding, potentially revealing complex aspects of yrrS function that neither computational nor experimental approaches could identify in isolation.

What emerging technologies might revolutionize our understanding of uncharacterized membrane proteins like yrrS in the next decade?

Several emerging technologies are poised to transform our understanding of uncharacterized membrane proteins like yrrS over the next decade:

  • Advances in structural biology:

    • Cryo-electron tomography with subtomogram averaging for in situ structure determination

    • Micro-electron diffraction (MicroED) for structure determination from nanocrystals

    • Integrative hybrid methods combining multiple experimental datasets with computational modeling

    • Serial femtosecond crystallography using X-ray free-electron lasers for room-temperature structures without radiation damage

    • These techniques will enable structural determination of membrane proteins in near-native environments, potentially revealing how yrrS integrates within complex membrane architectures like those containing MreB filaments in B. subtilis

  • AI-driven approaches:

    • Deep learning structure prediction building on AlphaFold2 with membrane-specific training

    • Machine learning for functional annotation based on structural patterns

    • Automated experimental design to efficiently characterize novel proteins

    • Neural network-based integrative modeling combining sparse experimental data

    • These computational advances will accelerate hypothesis generation and guide targeted experiments for proteins like yrrS

  • Single-molecule technologies:

    • Super-resolution fluorescence microscopy for tracking individual proteins in bacterial membranes

    • High-speed atomic force microscopy to observe conformational dynamics in real-time

    • Single-molecule FRET for measuring discrete conformational states

    • Nanopore-based electrical recordings of individual membrane protein activity

    • These approaches will provide unprecedented insights into the dynamic behavior of yrrS in its native environment

  • Advanced genetic and genome engineering:

    • CRISPR interference (CRISPRi) for precise temporal control of gene expression

    • Multiplex genome engineering for creating comprehensive mutation libraries

    • In vivo directed evolution specifically designed for membrane proteins

    • Synthetic genomics for creating minimal cells to study essential membrane functions

    • These genetic tools will enable systematic functional characterization of yrrS and its interaction partners

  • Next-generation proteomics:

    • Top-down proteomics for analyzing intact membrane proteins with post-translational modifications

    • Crosslinking mass spectrometry with membrane-specific crosslinkers

    • Thermal proteome profiling to identify ligands and interaction partners

    • Spatial proteomics revealing subcellular localization patterns

    • These approaches will provide comprehensive characterization of yrrS protein interactions and modifications

  • Microfluidic and organ-on-chip technologies:

    • Microfluidic platforms for high-throughput functional screening

    • Artificial membrane systems with precise control over composition

    • Bacteria-on-chip devices for real-time monitoring of cellular responses

    • Droplet microfluidics for single-cell analysis of membrane protein function

    • These technologies will enable functional testing under controlled, physiologically relevant conditions

  • Synthetic biology approaches:

    • Minimal synthetic membranes reconstituted with defined components

    • Orthogonal translation systems for unnatural amino acid incorporation

    • Cell-free expression platforms optimized for membrane proteins

    • Logic-gated protein circuits to probe membrane protein networks

    • These synthetic approaches will allow testing of yrrS function in defined, controllable systems

These emerging technologies will collectively enable a comprehensive, multi-scale understanding of uncharacterized membrane proteins like yrrS, from atomic structure to cellular function, transforming our ability to study these challenging but critically important components of bacterial cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.