Recombinant Bacillus subtilis Uncharacterized membrane protein ysxD (ysxD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bacillus subtilis Uncharacterized Membrane Protein ysxD (ysxD)

The recombinant Bacillus subtilis uncharacterized membrane protein ysxD (UniProt: P40736) is a full-length integral membrane protein expressed in E. coli for research purposes. It belongs to the BSU28180 locus and is annotated as a putative membrane component with conserved amino acid motifs . Despite its designation as "uncharacterized," bioinformatics and interaction studies suggest potential roles in membrane-associated processes, including tetrapyrrole biosynthesis .

Key Features of Recombinant ysxD Protein

ParameterValue
Source OrganismBacillus subtilis (strain 168)
Expression HostE. coli
TagN-terminal 10xHis-tag
Protein LengthFull-length (1–165 amino acids)
Molecular Weight~18.7 kDa (calculated)
Storage BufferTris-based buffer with 50% glycerol, pH 8.0
Purity>90% (SDS-PAGE validated)
SequenceMKQKSILFPCLLLAASVYAWLESGQAELFSGQDQWPVLLMLLGAAFVYQGKKEAVTPHFF... (full sequence in )

The protein contains hydrophobic transmembrane domains and hydrophilic regions, consistent with integral membrane proteins .

Predicted Functional Partners

Bioinformatics analyses via STRING-db reveal interactions with enzymes in the heme biosynthesis pathway :

Interacting ProteinFunctionInteraction Score
hemXNegative regulator of glutamyl-tRNA reductase HemA0.542
hemAGlutamyl-tRNA reductase (GSA synthesis)0.542
hemBDelta-aminolevulinic acid dehydratase (porphobilinogen synthase)0.496
hemCPorphobilinogen deaminase (hydroxymethylbilane synthase)0.496
hemLGlutamate-1-semialdehyde aminotransferase0.461

These interactions suggest ysxD may modulate tetrapyrrole biosynthesis, though experimental validation is lacking .

Expression and Purification

  • Expression System: E. coli with N-terminal His-tag for affinity chromatography .

  • Purification: Nickel affinity chromatography followed by SDS-PAGE validation .

  • Reconstitution: Lyophilized protein is reconstituted in deionized water (0.1–1.0 mg/mL) with optional glycerol (5–50%) for stability .

Potential Uses

  1. Membrane Protein Biogenesis Studies:

    • Investigating insertion mechanisms (e.g., Oxa1 vs. SecY pathways) .

    • Analyzing transmembrane domain folding and stability .

  2. Tetrapyrrole Biosynthesis Research:

    • Exploring regulatory roles in heme production via interaction with hem enzymes .

  3. Structural Biology:

    • Crystallization trials using detergents and conditions optimized for membrane proteins .

Challenges

  • Functional Elucidation: Limited experimental data on enzymatic activity or biochemical role .

  • Structural Determination: No high-resolution structures are currently available in the PDB .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ysxD; BSU28180; Uncharacterized membrane protein YsxD; ORFY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ysxD
Target Protein Sequence
MKQKSILFPCLLLAASVYAWLESGQAELFSGQDQWPVLLMLLGAAFVYQGKKEAVTPHFF IGLLLFGIGLHFFAKPKWVWWPDDFEMLLFMIGFSLLVSTVQKKEYVYEAVSMICFSLFL YFFKQIMAWLESAHIPTALLKEYWPFVFIGISLLLLLIKRKKSIR
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is currently known about YsxD protein in Bacillus subtilis?

YsxD is classified as an uncharacterized membrane protein in Bacillus subtilis. While specific information about YsxD is limited in the literature, it belongs to a category of proteins that require dedicated research approaches for characterization. Similar to other membrane proteins in B. subtilis like YsxC, which is known to interact with ribosomes, membrane proteins often play crucial roles in cellular processes . YsxD likely resides in the cell membrane and may participate in important cellular functions that have yet to be fully elucidated through experimental investigation.

What methods are recommended for initial characterization of an uncharacterized membrane protein like YsxD?

Initial characterization of uncharacterized membrane proteins typically follows a systematic approach:

  • Sequence analysis and structural prediction: Begin with bioinformatics approaches to predict transmembrane domains, potential functional motifs, and protein family relationships.

  • Expression and purification optimization: Test multiple expression systems including E. coli-based systems with appropriate detergents for membrane protein solubilization.

  • Localization studies: Confirm membrane localization using techniques such as membrane fractionation and fluorescent protein tagging.

  • Preliminary functional assays: Based on predicted domains, design experiments to test potential functions, similar to approaches used for characterizing proteins like YsxC .

How should I design an expression system for recombinant YsxD production?

When designing an expression system for YsxD production, consider the following methodology:

  • Vector selection: Choose vectors with tunable promoters that allow controlled expression levels, as membrane proteins can be toxic when overexpressed.

  • Host strain selection: Consider B. subtilis expression systems for homologous expression or E. coli strains optimized for membrane protein expression.

  • Fusion tag strategy: Incorporate tags that facilitate detection and purification (His-tag, FLAG-tag) while minimizing interference with membrane insertion.

  • Growth conditions: Test expression at lower temperatures (16-25°C) and with reduced inducer concentrations to enhance proper folding, similar to approaches used for other membrane proteins .

  • Solubilization screening: Test multiple detergents and buffer conditions to identify optimal solubilization parameters for downstream applications.

What control proteins should be included when studying YsxD function?

When studying an uncharacterized protein like YsxD, proper controls are essential:

  • Positive controls: Include well-characterized membrane proteins from B. subtilis with known localization patterns and functional properties, such as YsxC .

  • Negative controls: Utilize non-membrane proteins or membrane proteins from different cellular compartments to confirm specificity of localization and functional assays.

  • Related protein controls: If possible, include related proteins like YvoD, which is also classified as an uncharacterized membrane protein in B. subtilis .

  • Mutant variants: Generate non-functional mutants with alterations in predicted functional domains to validate assay specificity.

How can I design a comprehensive deletion analysis to study YsxD function?

When designing a deletion analysis to study YsxD function, implement the following methodology:

  • Gene knockout strategy: Create a complete deletion using homologous recombination techniques in B. subtilis.

  • Growth condition assessment: Evaluate deletion mutant growth under various stress conditions (temperature, pH, salt, antibiotics) to identify potential phenotypes.

  • Complementation testing: Reintroduce the wild-type gene under a controlled promoter to verify phenotype rescue.

  • Domain-specific deletions: Generate a series of partial deletions targeting specific domains to identify critical functional regions.

Table 1: Recommended Deletion Analysis Strategy for YsxD

Deletion TypeTechniqueExpected OutcomeKey Controls
Complete gene knockoutCRISPR-Cas9 or allelic replacementViability assessment, growth phenotypeWild-type strain, complemented strain
N-terminal domain deletionSite-directed mutagenesisLocalization changes, functional impactWild-type YsxD expression
Transmembrane domain deletionDomain-specific deletionMembrane insertion defectsOther membrane protein controls
C-terminal domain deletionTruncation constructsFunctional changes with intact localizationGraduated series of truncations
Internal domain deletionIn-frame deletionDomain-specific functional lossPoint mutations in same region

What approaches should I use to identify potential interaction partners of YsxD?

To identify potential interaction partners of YsxD, implement a multi-faceted approach:

  • Co-immunoprecipitation: Use epitope-tagged YsxD to pull down interaction partners, followed by mass spectrometry analysis.

  • Bacterial two-hybrid screening: Employ bacterial two-hybrid systems adapted for membrane proteins to identify direct protein-protein interactions.

  • Chemical cross-linking: Utilize membrane-permeable cross-linking agents followed by mass spectrometry to capture transient or weak interactions in vivo, similar to techniques used to study YidD-nascent protein interactions .

  • Co-localization studies: Perform fluorescent protein fusion co-localization experiments to identify proteins that share spatial distribution with YsxD.

  • Genetic interaction screening: Conduct synthetic genetic array analysis to identify genes that show genetic interactions with YsxD, suggesting functional relationships.

How should I design experiments to determine if YsxD is involved in membrane protein insertion?

Given that some uncharacterized membrane proteins are involved in membrane protein insertion (like YidD in E. coli ), consider the following experimental design approach:

  • Measure insertion efficiency: Monitor the insertion efficiency of model membrane proteins in wild-type versus ΔysxD strains using reporter fusions.

  • Cross-linking analysis: Perform in vivo cross-linking experiments to determine if YsxD is in proximity to nascent membrane proteins during their insertion, similar to approaches used for YidD .

  • Ribosome association testing: Investigate whether YsxD associates with ribosomes or the Sec translocon using co-sedimentation assays or pull-down experiments, drawing parallels to YsxC's ribosome association .

  • Synthetic genetic analysis: Test for genetic interactions between ysxD and genes encoding known membrane insertion factors (secY, secA, yidC homologs) to identify potential functional relationships.

Table 2: Experimental Approaches for Assessing Membrane Protein Insertion Function

Experimental ApproachMethodologyExpected Outcome if YsxD Functions in InsertionControls Required
Model protein insertion assayReporter fusion expression in WT vs. ΔysxDReduced insertion efficiency in mutantKnown insertion factor mutants
In vivo cross-linkingDSP or formaldehyde cross-linkingYsxD cross-links to nascent membrane proteinsNon-membrane protein controls
Ribosome/translocon associationSucrose gradient sedimentationCo-sedimentation with ribosomes or Sec componentsYsxC positive control
Conditional depletion phenotypingRegulated expression of YsxDAccumulation of membrane protein precursorsOther membrane insertion factors
Complementation assaysExpression of YsxD in YidC-depleted cellsRescue of insertion defects if functionally relatedYidC complementation control

How can I resolve contradictory data regarding YsxD function in different genetic backgrounds?

When faced with contradictory data about YsxD function in different genetic backgrounds, implement this systematic approach:

  • Strain comparison analysis: Sequence the genomic context of ysxD in different strains to identify potential compensatory mutations or genetic modifiers.

  • Complementation testing: Perform cross-complementation experiments by expressing ysxD from one strain background in deletion mutants from other backgrounds.

  • Conditional phenotype assessment: Test phenotypes under various growth conditions to identify strain-specific dependencies, similar to the approach used for analyzing rodZ phenotypes in different B. subtilis strains .

  • Suppressor screening: Identify spontaneous suppressors of phenotypes in one strain background and test if those suppressors act in other backgrounds.

What techniques should I use to characterize YsxD topology and membrane integration?

To characterize YsxD topology and membrane integration, employ a comprehensive set of techniques:

  • Cysteine accessibility scanning: Introduce cysteine residues throughout the protein and test their accessibility to membrane-impermeable sulfhydryl reagents to map topology.

  • Fusion protein analysis: Create fusions with reporter proteins (GFP, PhoA, LacZ) at different positions to determine cytoplasmic versus periplasmic localization of domains.

  • Protease protection assays: Perform protease digestion of membrane preparations to identify protected versus exposed regions.

  • Amphipathicity analysis: Analyze the sequence for potential amphipathic helices that might mediate membrane association without transmembrane segments, similar to the approach used to analyze YidD .

How can high-content microscopy screening be adapted to study the impact of YsxD on cell morphology?

High-content microscopy screening (HCS) can be adapted to study YsxD's impact on cell morphology using methodology similar to that described for other B. subtilis proteins :

  • Optimization of fixation protocol: Develop fixation protocols that preserve native cell morphology while enabling high-throughput imaging, considering that fixation may slightly reduce cell width as observed in other studies .

  • Magnesium supplementation consideration: Evaluate whether growth media should be supplemented with magnesium (20 mM MgSO4) to prevent perturbation of growth and accurate estimation of cell width in mutants potentially defective in cell wall synthesis .

  • Validation with known morphology mutants: Include control strains with known morphological phenotypes (wider or thinner than wild-type) to validate the sensitivity of the assay .

  • Quantitative phenotyping: Develop automated image analysis workflows to quantify multiple morphological parameters beyond width, including length, curvature, and division site positioning.

What approaches can determine if YsxD has GTPase activity similar to YsxC?

To investigate whether YsxD possesses GTPase activity similar to the related protein YsxC , implement these methodological approaches:

  • Sequence analysis: Analyze YsxD sequence for conserved GTPase motifs (P-loop, switch regions) found in YsxC and other GTPases.

  • In vitro GTPase assay: Purify recombinant YsxD and perform in vitro GTPase activity assays using radiolabeled or fluorescent GTP analogs.

  • Nucleotide binding analysis: Assess GTP binding using methods such as thermal shift assays or nucleotide-analog affinity chromatography.

  • Activity modulation testing: Determine if YsxD's potential GTPase activity is stimulated by cellular components like ribosomes, as observed with YsxC .

  • Mutational analysis: Create mutations in predicted nucleotide-binding motifs and assess their impact on potential GTPase activity and in vivo function.

How can I determine if YsxD interacts with specific RNA species like YsxC does with rRNA?

To investigate potential RNA interactions of YsxD, similar to YsxC's interaction with 16S and 23S rRNA , employ these methodological approaches:

  • RNA co-immunoprecipitation: Perform RNA co-immunoprecipitation (RIP) with tagged YsxD followed by RT-PCR or RNA sequencing to identify associated RNA species.

  • Electrophoretic mobility shift assay (EMSA): Conduct EMSAs with purified YsxD and candidate RNA molecules to detect direct binding interactions.

  • UV cross-linking: Utilize UV cross-linking followed by immunoprecipitation to capture direct RNA-protein interactions in vivo.

  • Structure-specific RNA binding analysis: Test binding to specific RNA structural elements using a panel of structured RNA constructs.

Table 3: Comparison of RNA Interaction Analysis Methods

MethodAdvantagesLimitationsApplication to YsxD Research
RNA co-immunoprecipitationIdentifies interactions in vivoMay capture indirect interactionsIdentify all RNA species associated with YsxD
EMSADemonstrates direct bindingIn vitro conditions may not reflect cellular environmentTest specific binding to rRNAs as seen with YsxC
UV cross-linkingCaptures direct interactionsCross-linking efficiency varies with RNA-protein pairsConfirm direct RNA contacts identified by other methods
Gradient sedimentationAssociates with cellular complexesDoesn't prove direct bindingDetermine if YsxD co-sediments with ribosomal fractions
CLIP-seqMaps binding sites at nucleotide resolutionTechnically challengingDefine precise RNA binding motifs if initial screens show RNA binding

What experimental approaches would determine if YsxD is part of a gene cluster with coordinated expression?

To investigate if YsxD is part of a gene cluster with coordinated expression, similar to the conserved gene clusters observed in bacteria like E. coli , implement the following approaches:

  • Operon structure analysis: Perform RT-PCR with primers spanning adjacent genes to determine if YsxD is co-transcribed with neighboring genes.

  • Transcriptome profiling: Conduct RNA-seq under various growth conditions to identify genes with expression patterns that correlate with ysxD.

  • Promoter mapping: Use 5' RACE or primer extension analysis to identify transcriptional start sites and infer operon structure.

  • Reporter fusion analysis: Create transcriptional and translational fusions to monitor expression patterns of ysxD and surrounding genes under various conditions.

  • Comparative genomics: Analyze gene organization across multiple Bacillus species to identify conserved gene clusters containing ysxD, which may suggest functional relationships.

How can I investigate the stoichiometry of YsxD in membrane protein complexes?

To determine the stoichiometry of YsxD in potential membrane protein complexes, employ these methodological approaches:

  • Blue native PAGE: Use blue native PAGE to isolate intact membrane protein complexes containing YsxD and analyze their composition.

  • Single-molecule fluorescence: Apply techniques like single-molecule photobleaching to count the number of YsxD molecules in a complex.

  • Mass spectrometry: Utilize native mass spectrometry of purified complexes to determine precise stoichiometry, similar to approaches used to study the stoichiometry of YsxC-ribosome complexes .

  • FRET analysis: Perform Förster resonance energy transfer experiments with differentially labeled YsxD molecules to assess self-association.

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Determine absolute molecular weight of purified complexes to infer stoichiometry.

What high-resolution structural techniques are most appropriate for YsxD characterization?

For high-resolution structural characterization of YsxD, consider these methodological approaches:

  • X-ray crystallography: Optimize crystallization conditions for purified YsxD, potentially in complex with stabilizing antibody fragments or fusion partners.

  • Cryo-electron microscopy: Apply single-particle cryo-EM for structure determination, particularly useful if YsxD forms part of a larger complex.

  • NMR spectroscopy: Consider solution NMR for structural analysis of individual domains or segments, particularly if the full-length protein proves challenging.

  • Integrative structural biology: Combine multiple lower-resolution techniques (SAXS, cross-linking mass spectrometry, computational modeling) to build structural models.

How can I design experiments to determine if YsxD affects cellular response to stress conditions?

To investigate YsxD's potential role in stress responses, implement this experimental design approach:

  • Stress condition screening: Test growth and survival of wild-type versus ΔysxD strains under various stresses (temperature, pH, osmotic stress, antibiotics).

  • Transcriptome analysis: Perform RNA-seq comparing wild-type and ΔysxD strains under normal and stress conditions to identify differentially regulated genes.

  • Membrane integrity assessment: Evaluate membrane permeability and potential defects using fluorescent dyes in wild-type versus ΔysxD strains under stress conditions.

  • Protein misfolding analysis: Assess accumulation of misfolded proteins using reporter systems in the absence of YsxD, particularly under stress conditions.

Table 4: Experimental Design for Stress Response Analysis

Stress ConditionMeasurement ParametersExpected Phenotype if YsxD InvolvedControls
Heat stress (42-45°C)Growth rate, survival, proteome stabilityIncreased sensitivity in ΔysxDKnown heat-sensitive mutants
Osmotic stressGrowth in high salt, compatible solute productionMembrane integrity defectsMembrane integrity controls
Antibiotic stressMIC determination for cell wall/membrane antibioticsAltered sensitivity to specific antibioticsKnown antibiotic-sensitive mutants
Oxidative stressSurvival after H₂O₂ exposureOxidative damage to membrane componentsOxidative stress-sensitive controls
pH stressGrowth at low/high pHpH homeostasis defectspH-sensitive mutant controls

What approaches would determine if YsxD plays a role in cell width regulation similar to proteins identified in high-content screening?

To investigate whether YsxD influences cell width regulation, similar to proteins identified in high-content screening studies of B. subtilis , implement these methodological approaches:

  • Quantitative morphology analysis: Perform precise measurements of cell width, length, and aspect ratio in wild-type versus ΔysxD strains using fluorescence microscopy and automated image analysis.

  • Cell wall composition analysis: Analyze peptidoglycan composition and cross-linking in ΔysxD strains to identify potential alterations in cell wall structure.

  • Cytoskeletal protein localization: Examine the localization of width-determining cytoskeletal proteins (MreB, Mbl) in the absence of YsxD.

  • Genetic interaction testing: Test for genetic interactions between ysxD and genes known to affect cell width (mreB, ponA) to identify potential functional relationships .

  • High magnesium condition testing: Evaluate whether growth in high magnesium conditions (20 mM MgSO4) suppresses any morphological phenotypes in ΔysxD strains, as observed for certain cell wall mutants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.