Recombinant Bacillus subtilis Uncharacterized membrane protein ytaB (ytaB)

Shipped with Ice Packs
In Stock

Description

Introduction

Bacillus subtilis is a Gram-positive bacterium well-regarded for its ability to produce recombinant proteins, its general recognition as a safe (GRAS) organism, and its proficiency in incorporating exogenous DNA . Bacillus subtilis contains a strict quality control system for proteins dependent on its machinery and performed by intracellular and extracytoplasmic chaperones, cell wall proteases, and extracellular proteases . These attributes make it a valuable platform for expressing bioactive substances through genetic engineering, including the uncharacterized membrane protein YtaB .

Characteristics of Bacillus subtilis as an Expression System

Bacillus subtilis is a preferred host for recombinant protein production due to several advantageous features:

  • GRAS Status: Its classification as generally recognized as safe ensures it is suitable for various biotechnological applications .

  • Genetic Accessibility: Bacillus subtilis's ability to uptake and integrate exogenous DNA simplifies genetic manipulation .

  • Versatile Genetic Tools: A range of genetic engineering strategies, including different plasmids, constitutive or double promoters, chemical inducers, and self-inducing expression systems, enhance its utility .

  • Secretion Systems: Bacillus subtilis possesses multiple protein export systems, such as the Sec-dependent pathway and the Twin-arginine translocation (Tat) system, facilitating the secretion of recombinant proteins .

YtaB: An Uncharacterized Membrane Protein

YtaB is an uncharacterized membrane protein in Bacillus subtilis for which limited information is available. Proteins like YtaB can be expressed using recombinant Bacillus subtilis strains, potentially offering insights into their functions and applications.

Recombinant Production and Antimicrobial Activity

Recombinant Bacillus subtilis can be engineered to express various proteins, including antimicrobial peptides. For example, Bacillus subtilis strains have been created to express fusion peptides like porcine β-defensin-2 (pBD-2) and cecropin P1 (CP1), demonstrating antimicrobial activity against Gram-negative and Gram-positive bacteria .

Case Study: Expression of pBD-2/CP1 Fusion Peptide

One study successfully constructed a recombinant Bacillus subtilis strain to express a pBD-2/CP1 fusion peptide, which exhibited antimicrobial activity against several bacteria, including E. coli, Salmonella typhimurium, Haemophilus parasuis, and Staphylococcus aureus . Codon optimization was performed to enhance the expression of porcine pBD-2 and cecropin P1 in B. subtilis . The synthesized pBD-2/cecropin P1 fusion gene was cloned into pMK4 plasmid, to generate pBD-2/cecropin P1 fusion gene expression vector (pMK4-pBD/CP/His) .

Enhancing Protein Expression

Several strategies can enhance protein expression in recombinant Bacillus subtilis:

  • Codon Optimization: Modifying the gene sequence to use codons preferred by Bacillus subtilis can significantly improve expression levels .

  • Promoter Selection: Utilizing strong and regulated promoters can control the timing and level of protein expression . For example, the xylose-inducible xylA promoter has been used to express the AraE protein, enhancing xylose transport and cell growth .

  • Fusion Tags: Adding tags such as a six-histidine tag to the target protein aids in purification using affinity chromatography .

Applications of Recombinant Bacillus subtilis

Recombinant Bacillus subtilis has numerous applications:

  • Antimicrobial Production: Production of antimicrobial peptides and proteins to combat bacterial infections .

  • Enzyme Production: Expression of enzymes for industrial processes .

  • Bioremediation: Utilization of engineered strains to degrade pollutants .

  • Vaccine Development: Production of vaccine antigens .

Challenges and Future Directions

Despite its advantages, using Bacillus subtilis as an expression system faces challenges:

  • Protease Activity: Bacillus subtilis produces extracellular proteases that can degrade target proteins .

  • Secretion Efficiency: Ensuring efficient secretion of recombinant proteins can be difficult .

Future research should focus on:

  • Improving Secretion Pathways: Developing strategies to enhance the secretion of recombinant proteins .

  • Reducing Protease Activity: Engineering strains with reduced protease activity to improve protein stability .

  • Exploring New Inducers: Identifying cost-effective inducers to enhance protein expression .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C or -80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C or -80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ytaB; BSU30930; Uncharacterized membrane protein YtaB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ytaB
Target Protein Sequence
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISL SAAIVYAAFSFKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLI IAKKYSRAASYLLLPYFLWSAFATFLSFTINSMNL
Uniprot No.

Target Background

Database Links
Protein Families
TspO/BZRP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the current knowledge status of ytaB in Bacillus subtilis?

ytaB is classified as an uncharacterized membrane protein in Bacillus subtilis. While the protein has been identified in genomic studies, its specific function remains largely unknown. Current research indicates it is part of the membrane proteome, but unlike well-studied proteins such as those in the YtrBCDEF ABC transporter system, ytaB's role in cellular processes has not been comprehensively characterized . The protein appears in databases as a partial recombinant protein available for research purposes, suggesting ongoing efforts to elucidate its structure and function.

What expression systems are most effective for recombinant production of ytaB?

For recombinant production of B. subtilis membrane proteins like ytaB, researchers should consider several expression system options:

  • Homologous expression: Using B. subtilis itself as an expression host offers advantages for membrane protein production, as it eliminates potential issues with codon bias and protein folding. Recent advances in B. subtilis chassis cell engineering have improved its capacity as a microbial cell factory, making it increasingly suitable for recombinant protein expression .

  • E. coli expression systems: While often used for recombinant protein production, these may require optimization for membrane proteins from Gram-positive bacteria like B. subtilis.

  • Cell-free expression systems: These can be particularly valuable for difficult-to-express membrane proteins.

The most effective approach often combines codon optimization, careful selection of fusion tags, and controlled induction parameters. When working with uncharacterized membrane proteins, parallel testing of multiple expression systems is recommended to identify optimal conditions.

What purification challenges are specific to ytaB as a membrane protein?

Purification of ytaB presents typical membrane protein challenges including:

  • Solubilization efficiency: Selecting appropriate detergents is critical. Commonly, a screening approach with detergents ranging from mild (DDM, LMNG) to stronger (SDS) is necessary to determine optimal solubilization conditions.

  • Protein stability: After extraction from the membrane environment, ytaB may show reduced stability. Adding lipids or using amphipols during purification can help maintain protein integrity.

  • Purification yield: Membrane proteins typically express at lower levels than soluble proteins. Scale-up strategies may be necessary, potentially utilizing the advanced B. subtilis chassis cell technologies that have demonstrated improvements in recombinant protein production .

  • Functionality verification: Since ytaB is uncharacterized, developing activity assays presents an additional challenge that may require comparison with structurally similar proteins from related bacteria.

How can researchers determine the potential function of ytaB?

When investigating an uncharacterized protein like ytaB, multiple approaches should be employed:

  • Bioinformatic analysis:

    • Sequence homology comparisons with characterized proteins

    • Structural prediction tools to identify functional domains

    • Genomic context analysis to identify neighboring genes that may have related functions

  • Experimental approaches:

    • Gene knockout studies to observe phenotypic changes

    • Transcriptomic analysis under various conditions to determine when ytaB is expressed

    • Protein-protein interaction studies to identify binding partners

  • Network-based approaches:

    • Integration into known regulatory networks using methods similar to those employed for B. subtilis global transcriptional regulatory network analysis

    • Network component analysis to predict regulatory interactions

When applied to ytaB, these approaches might reveal patterns similar to other membrane proteins in B. subtilis that have established roles in processes like competence development, stress response, or biofilm formation .

How does ytaB potentially relate to Bacillus subtilis stress response mechanisms?

While specific information about ytaB's role in stress response is limited, research approaches can be guided by known B. subtilis stress mechanisms:

  • B. subtilis employs complex stress response systems, including the general stress response controlled by the σB transcription factor, which regulates approximately 75-150 genes under various stress conditions .

  • Investigation methods should include:

    • Exposing ytaB mutant strains to various stressors (heat, salt, ethanol, oxidative agents) and comparing survival rates to wild-type strains

    • Transcriptomic analysis to determine if ytaB expression changes during stress conditions

    • Comparative analysis with known stress-responsive membrane proteins like YjbI, which prevents oxidative damage to cell-surface proteins

  • Given the importance of membrane proteins in sensing and responding to environmental changes, ytaB may function in stress signaling or protection of membrane integrity during stress conditions.

What techniques are most suitable for determining ytaB's subcellular localization and topology?

For membrane proteins like ytaB, determining precise subcellular localization and topology is essential for functional characterization:

  • Fluorescent protein fusion techniques:

    • C-terminal and N-terminal GFP fusions can indicate localization patterns

    • Split-GFP complementation assays can verify membrane topology

  • Immunolocalization approaches:

    • Using antibodies against epitope-tagged versions of ytaB

    • Differential staining with and without membrane permeabilization

  • Biochemical fractionation:

    • Separation of cellular components followed by Western blotting to track ytaB

    • Protease accessibility tests to determine exposed regions

  • Computational prediction:

    • Transmembrane domain prediction software to establish topology models

    • Signal sequence analysis for cellular targeting information

A comprehensive approach would involve cross-validation using multiple methods, as demonstrated in studies of other B. subtilis membrane proteins like those in the YtrBCDEF ABC transporter system .

How might ytaB interact with the genetic competence machinery?

Genetic competence in B. subtilis is a complex developmental program enabling DNA uptake that occurs during stationary phase and high cell density . To investigate potential ytaB involvement:

  • Competence phenotype testing:

    • Create ytaB knockout strains and measure transformation efficiency

    • Determine if ytaB expression changes during competence development using qRT-PCR

    • Test for epistatic relationships with known competence regulators like ComK

  • Mechanistic considerations:

    • Investigate potential interactions with the DNA uptake apparatus

    • Test if ytaB affects cell wall properties that might influence DNA binding and uptake

    • Examine potential regulatory connections to competence signal transduction pathways

  • Integration with existing models:

    • Apply network component analysis similar to that used for establishing the B. subtilis global transcriptional regulatory network

    • Determine if ytaB functions upstream (in ComK activation) or downstream (in DNA uptake) of competence gene expression

The research on YtrA transcription factor and the YtrBCDEF ABC transporter provides a useful model, as it demonstrated that these proteins affect both ComK activity and downstream processes of DNA uptake and integration .

What potential role might ytaB play in biofilm formation?

Biofilm formation in B. subtilis involves complex multicellular processes. To investigate ytaB's potential role:

  • Phenotypic analysis:

    • Compare biofilm formation in wild-type versus ytaB mutant strains

    • Evaluate structural properties of biofilms including water repellence, matrix integrity, and cell distribution

  • Interaction with known biofilm components:

    • Investigate potential interactions with known matrix proteins like TasA

    • Examine expression patterns during different stages of biofilm development

    • Test for colocalization with biofilm matrix components

  • Mechanistic hypotheses:

    • Examine if ytaB affects cell wall properties critical for biofilm formation

    • Investigate potential roles in intercellular signaling within biofilms

    • Test for involvement in environmental sensing that regulates biofilm development

Research on the YtrBCDEF ABC transporter showed that its constitutive expression interferes with biofilm formation and affects cell wall thickness . Similarly, the truncated hemoglobin YjbI localizes to the cell surface or biofilm matrix and is involved in preventing oxidative aggregation of the biofilm matrix protein TasA . These provide useful models for investigating ytaB's potential biofilm-related functions.

What high-throughput approaches can be applied to functionally characterize ytaB?

Modern high-throughput techniques offer powerful approaches for characterizing uncharacterized proteins like ytaB:

  • Comparative transcriptomics and proteomics:

    • RNA-Seq comparing wild-type and ytaB mutant strains under various conditions

    • Proteome profiling to identify changes in protein expression patterns

    • Metabolomics to detect alterations in cellular metabolites

  • Interaction screening methods:

    • Bacterial two-hybrid screening to identify protein interaction partners

    • Co-immunoprecipitation coupled with mass spectrometry

    • Crosslinking mass spectrometry for capturing transient interactions

  • Functional genomics approaches:

    • Transposon mutagenesis to identify genetic interactions

    • CRISPRi screens to identify synthetic lethal or synthetic rescue interactions

    • Chemical genomics to identify conditions where ytaB becomes essential

These approaches should be designed following the model of successful studies like the comprehensive analysis of B. subtilis general stress response, which combined transcriptomics, mutant analysis, and targeted validation experiments .

ApproachAdvantagesLimitationsSuitable Applications for ytaB
TranscriptomicsGenome-wide expression patternsIndirect functional evidenceIdentifying conditions affecting ytaB expression
ProteomicsDirect protein level evidenceLimited detection of membrane proteinsIdentifying ytaB interaction partners
Phenotypic screeningDirect functional relevanceLabor intensiveIdentifying conditions where ytaB is important
Network analysisIntegrates multiple data typesRequires existing network informationPlacing ytaB in regulatory context

How can researchers effectively study protein-protein interactions involving ytaB?

Membrane protein interaction studies present unique challenges but are critical for understanding ytaB function:

  • Membrane-specific interaction methods:

    • MYTH (Membrane Yeast Two-Hybrid) system optimized for membrane proteins

    • FRET/BRET approaches using fluorescent protein fusions

    • Proximity labeling techniques (BioID, APEX) to identify neighboring proteins

  • Stabilization strategies:

    • Detergent screening to maintain protein-protein interactions

    • Nanodiscs or liposome reconstitution to mimic native membrane environment

    • Crosslinking approaches to capture transient interactions

  • Validation approaches:

    • Co-purification studies with putative interaction partners

    • Mutational analysis of interaction interfaces

    • Functional assays to verify biological relevance of interactions

These methods could reveal whether ytaB interacts with other membrane systems in B. subtilis, such as the YtrBCDEF ABC transporter, which has been shown to influence cell wall properties, competence development, and biofilm formation .

How can structural studies of ytaB inform its functional characterization?

Structural information provides critical insights for uncharacterized proteins like ytaB:

  • Structural determination approaches:

    • X-ray crystallography (requiring detergent optimization and crystallization screening)

    • Cryo-electron microscopy (particularly suitable for membrane proteins)

    • NMR for structural elements and dynamics

    • Computational structure prediction using AlphaFold2 or similar tools

  • Structure-guided functional analysis:

    • Identification of potential ligand-binding sites

    • Mapping of conserved residues onto structural models

    • Structure-guided mutagenesis to test functional hypotheses

  • Comparative structural analysis:

    • Structural alignment with characterized membrane proteins

    • Identification of structural motifs associated with specific functions

    • Evolutionary analysis of structural conservation

For practical implementation, researchers should consider collaborating with structural biology groups specializing in membrane proteins, as these studies require specialized expertise and equipment.

How can ytaB be positioned within the global regulatory network of B. subtilis?

Integrating ytaB into the known regulatory framework requires systematic approaches:

  • Transcriptional regulation analysis:

    • Promoter analysis to identify potential transcription factor binding sites

    • ChIP-seq to identify transcription factors binding to the ytaB promoter region

    • Reporter gene assays to validate regulatory interactions

  • Network inference approaches:

    • Apply network component analysis (NCA) and model selection techniques similar to those used for expanding the B. subtilis transcriptional regulatory network

    • Estimate transcription factor activities across multiple conditions

    • Predict novel regulatory interactions affecting ytaB expression

  • Integration with existing network models:

    • Compare ytaB expression patterns with established regulons (σB general stress regulon, ECF sigma factors)

    • Test for dependencies on major regulatory systems (Spo0A, ComK, DegU)

The comprehensive approach used by Arrieta-Ortiz et al. for the B. subtilis global transcriptional regulatory network, which identified 2,258 novel regulatory interactions with high accuracy (62%), provides an excellent model for this integration .

What experimental design would best elucidate ytaB's function across different growth conditions?

A comprehensive experimental design should include:

  • Condition matrix approach:

Condition CategorySpecific ConditionsMeasurements
Growth phasesLag, exponential, stationary, sporulationytaB expression, localization, phenotypic effects
Stress conditionsHeat, salt, oxidative, nutrient limitationStress resistance, ytaB regulation, protein interactions
Developmental statesCompetence, biofilm formation, sporulationDevelopmental efficiency, ytaB localization
Genetic backgroundsRegulatory mutants (sigB, comK, degU)Epistatic relationships, regulatory dependencies
  • Time-course sampling:

    • High-resolution time-course experiments similar to those used for the B. subtilis life cycle analysis

    • Sampling during key transitions (e.g., entry to stationary phase, initiation of competence)

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and phenotypic data

    • Apply statistical approaches to identify conditions where ytaB is most active

This experimental design draws inspiration from the comprehensive approach used to analyze the B. subtilis general stress response, which examined multiple stress conditions and combined various analytical techniques .

What are the most promising research directions for understanding ytaB function?

Based on current knowledge of B. subtilis membrane proteins and regulatory systems, the most promising research directions include:

  • Integration with stress response systems:

    • Investigating potential roles in sensing or responding to environmental stresses

    • Examining possible connections to the σB general stress regulon

    • Testing for specific stress conditions where ytaB becomes essential

  • Cell envelope functionality:

    • Examining roles in cell wall synthesis or modification

    • Investigating potential impacts on membrane permeability or integrity

    • Testing for involvement in processes similar to those affected by YtrBCDEF ABC transporter

  • Developmental processes:

    • Detailed examination of roles in competence development

    • Investigation of potential functions in biofilm formation

    • Testing for involvement in sporulation or germination

  • Evolutionary context:

    • Comparative analysis across Bacillus species and related genera

    • Investigation of selective pressures on ytaB conservation

    • Analysis of co-evolution with interacting partners

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.