Recombinant Bacillus subtilis Uncharacterized membrane protein yteJ (yteJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates. Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process. Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yteJ; BSU29520; Uncharacterized membrane protein YteJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yteJ
Target Protein Sequence
MDATYEELERNDIKGPQEAELLTHAYAGFWVRFWAFLLDWLVIWGLNHLLVSPLFTVLDL PKTSGMFTFSAYSVTTLIVYLAYFALMTKYFRQTLGKMVFGLKVVSVKQDSKLTWSTVIF REVVGRYIDKIWILYIVVAFSPTKQGIHDYIADTTVVHEKLYRK
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the basic characteristics of the YteJ membrane protein in Bacillus subtilis?

YteJ is an uncharacterized membrane protein in Bacillus subtilis with a full length of 164 amino acids. It belongs to the category of integral membrane proteins, and while its specific function remains to be elucidated, it is available as a recombinant protein with His-tags for research purposes . The protein can be expressed in heterologous systems such as E. coli, which is commonly used for recombinant B. subtilis protein production. As a membrane protein, YteJ likely contains hydrophobic domains that facilitate its integration into the cell membrane, which presents specific challenges for expression, purification, and functional characterization that differ from those of soluble proteins.

What expression systems are most effective for producing recombinant B. subtilis membrane proteins like YteJ?

For recombinant expression of B. subtilis membrane proteins, researchers should consider several expression systems:

  • E. coli-based expression: The most common approach, utilizing expression vectors with strong promoters like T7 or tac. The YteJ protein has been successfully expressed in E. coli with His-tag modifications .

  • Native B. subtilis expression: This approach leverages B. subtilis as both the source and expression host, which may provide more natural folding conditions for membrane proteins.

  • Xylose-inducible systems: B. subtilis strains with the xylA promoter provide controlled expression when xylose is added to the medium. Similar to the approach used for the comK gene placed under control of a xylose-induced promoter (Genotype: his met srfA-lacZ [tet] amyE:: xylR Pxyl-comK [ery]) .

For membrane proteins specifically, expression methodologies should include:

  • Lower induction temperatures (16-30°C) to slow protein synthesis and facilitate proper folding

  • Addition of specific detergents during purification to maintain protein stability

  • Consideration of fusion partners that enhance membrane protein solubility and folding

B. subtilis offers advantages as an expression host due to its efficient secretion ability, high yield potential, and non-toxicity, making it valuable for recombinant protein production .

How can I optimize codon usage for efficient expression of recombinant YteJ protein?

Codon optimization significantly impacts recombinant protein expression efficiency. For YteJ expression, consider the following methodological approach:

For B. subtilis-specific expression, researchers can reference codon-optimization approaches used in other genetic constructs, such as the codon-optimized Methanococcus jannaschii-tyrosyl-tRNA synthetase (MjTyrRS) variant that was successfully expressed in B. subtilis . This approach resulted in high incorporation efficiency of non-standard amino acids, suggesting that similar optimization strategies could benefit YteJ expression.

What are the most effective methods for purifying the recombinant YteJ membrane protein?

Purification of membrane proteins like YteJ requires specialized approaches:

  • Membrane Fraction Isolation:

    • Harvest cells expressing recombinant YteJ

    • Disrupt cells via sonication or French press

    • Isolate membrane fraction through differential centrifugation

    • Solubilize membranes using appropriate detergents (e.g., DDM, LDAO, or Triton X-100)

  • Affinity Chromatography:

    • Utilize the His-tag present in recombinant YteJ constructs

    • Apply solubilized membrane fraction to Ni-NTA or TALON resin

    • Wash extensively to remove non-specifically bound proteins

    • Elute with imidazole gradient (50-300 mM)

  • Further Purification:

    • Size exclusion chromatography to separate aggregates and obtain monodisperse protein

    • Ion exchange chromatography for additional purity if required

  • Detergent Screening Table:

DetergentCMC (mM)Micelle Size (kDa)Recommendations for YteJ
DDM0.1770Initial extraction
LDAO1-221.5Crystallization attempts
Triton X-1000.2-0.980Functional assays
CHAPS8-106Mild solubilization

The specific methodological approach should be optimized for YteJ, potentially drawing from successful purification strategies used for other B. subtilis membrane proteins.

How can I determine if my purified recombinant YteJ protein is properly folded?

Assessing proper folding of membrane proteins like YteJ requires multiple analytical techniques:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-250 nm) to assess secondary structure content

    • Compare results with predicted secondary structure elements for YteJ

    • Evidence of α-helical content would appear as negative peaks at 208 and 222 nm

  • Thermal Stability Analysis:

    • Differential scanning calorimetry to determine protein melting temperature

    • Fluorescence-based thermal shift assays using environmentally sensitive dyes

    • Stability curve analysis in different detergent environments

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS):

    • Assess monodispersity and oligomeric state

    • Evaluate whether the protein-detergent complex size matches expectations

  • Limited Proteolysis:

    • Properly folded membrane proteins often show resistance to proteolytic digestion

    • Time-course analysis of proteolytic fragments can reveal structural domains

When working with uncharacterized proteins like YteJ, researchers should compare results with well-characterized membrane proteins from B. subtilis to establish appropriate benchmarks for proper folding.

What approaches can I use to determine the function of the uncharacterized YteJ membrane protein?

Unraveling the function of YteJ requires multiple complementary approaches:

  • Bioinformatic Analysis:

    • Sequence homology searches against characterized proteins

    • Identification of conserved domains and motifs

    • Structural prediction using programs like AlphaFold2

    • Genomic context analysis to identify functionally related genes

  • Gene Deletion and Complementation:

    • Create a ΔyteJ knockout strain in B. subtilis

    • Assess phenotypic changes (growth rates, stress responses, etc.)

    • Complement with wild-type and mutant variants of yteJ

    • Quantify restoration of phenotype to confirm function

  • Protein Interaction Studies:

    • Pull-down assays using His-tagged YteJ

    • Bacterial two-hybrid system to screen for protein partners

    • In vivo crosslinking to capture transient interactions

    • Mass spectrometry analysis of co-purified proteins

  • Transport Assays (if YteJ is suspected to be a transporter):

    • Similar to assessment methods used for AraE protein, which was shown to transport xylose efficiently in B. subtilis

    • Monitor uptake of radiolabeled substrates

    • Measure changes in membrane potential or ion flux

  • Genetic Code Expansion Application:

    • Incorporate non-standard amino acids at specific positions in YteJ

    • Use photocrosslinking or click chemistry to identify interaction partners

    • This approach has been successfully demonstrated in B. subtilis with 20 distinct non-standard amino acids

How can I establish if YteJ functions as a transporter protein in B. subtilis?

To determine if YteJ functions as a transporter protein, implement the following methodological approach:

  • Substrate Prediction and Screening:

    • Analyze YteJ sequence for transporter-specific motifs

    • Compare with known B. subtilis transporters like AraE (arabinose:H+ symporter)

    • Screen potential substrates based on growth phenotypes of ΔyteJ strains

  • Direct Transport Assays:

    • Prepare inside-out membrane vesicles containing overexpressed YteJ

    • Measure substrate accumulation using radioisotope-labeled compounds

    • Assess concentration-dependent kinetics to determine Km and Vmax values

  • Electrophysiological Measurements:

    • Reconstitute purified YteJ in planar lipid bilayers

    • Measure conductance changes upon substrate addition

    • Determine ion selectivity and gating properties

  • Complementation Analysis:

    • Similar to the approach used for AraE, which was expressed in B. subtilis 168 to transport xylose efficiently

    • Express YteJ in transporter-deficient strains and assess functional rescue

    • Systematically test substrate specificity through complementation assays

  • Batch Culture Experiments:

    • Conduct growth experiments with wild-type and ΔyteJ strains

    • Measure substrate consumption rates and coupling to energy parameters

    • Analyze respiratory quotient as performed with AraE in xylose transport studies

How can I use genetic code expansion techniques to study YteJ structure-function relationships?

Genetic code expansion provides powerful tools for investigating YteJ:

  • Synthetase Selection and Implementation:

    • Integrate codon-optimized aminoacyl-tRNA synthetase (AARS) into B. subtilis genome

    • Establish expression using promoters like pVeg/pSer for optimal incorporation

    • Choose amber stop codon (UAG) suppression for site-specific incorporation

  • Non-Standard Amino Acid Selection:

    • For crosslinking studies: incorporate photoreactive nsAAs like p-benzoyl-L-phenylalanine

    • For fluorescence studies: incorporate fluorescent nsAAs for direct visualization

    • For click chemistry: incorporate alkyne or azide-containing nsAAs for bioorthogonal labeling

  • Experimental Design:

    • Generate YteJ variants with amber codons at positions of interest

    • Express in presence of selected nsAAs and appropriate synthetase/tRNA pairs

    • Verify incorporation by mass spectrometry

  • Functional Analysis:

    • Use photocrosslinking to identify interaction partners at specific YteJ regions

    • Apply click chemistry to attach probes for localization studies

    • Employ fluorescent nsAAs to track YteJ dynamics in living cells

This approach has been successfully demonstrated in B. subtilis with the incorporation of 20 distinct non-standard amino acids using 3 different families of genetic code expansion systems , making it highly applicable to YteJ research.

What chromosomal integration strategies are most effective for stable expression of recombinant YteJ in B. subtilis?

For stable chromosomal integration of recombinant yteJ constructs:

  • Integration Loci Selection:

    • amyE locus: Non-essential gene encoding α-amylase, commonly used for integration

    • lacA locus: Successfully used for integration of genetic code expansion components

    • thrC locus: Another common integration site in B. subtilis

  • Integration Construct Design:

    • Promoter selection: Use xylose-inducible xylA promoter for controlled expression

    • Include appropriate terminators (e.g., fba terminator)

    • Add selection markers for transformant screening

  • Transformation Methods:

    • Natural competence: Induce competence state in B. subtilis

    • Protoplast transformation: For strains with poor natural competence

    • Electroporation: Higher efficiency for larger constructs

  • Expression Cassette Components:

    • Inducible promoter (e.g., xylA promoter induced by xylose)

    • Codon-optimized yteJ sequence

    • Fusion tags for detection and purification

    • Transcription terminator

  • Verification Strategies:

    • PCR confirmation of correct integration

    • Whole-genome sequencing to verify single-copy integration

    • Expression analysis through Western blotting

    • Functional assessment of the integrated construct

This approach mirrors successful strategies used for other recombinant proteins in B. subtilis, such as the AraE expression cassette that was integrated into the chromosomal amyE gene in B. subtilis 168 .

What are the key challenges and solutions when working with uncharacterized membrane proteins like YteJ?

Researchers face several challenges when working with uncharacterized membrane proteins:

ChallengeCauseSolution Methodology
Low expression levelsProtein toxicity, inefficient translationUse tightly regulated inducible promoters; optimize codon usage; consider fusion partners
Protein misfoldingIncompatible membrane environmentExpress at lower temperatures (16-30°C); screen various detergents for solubilization
Aggregation during purificationHydrophobic interactions between proteinsInclude glycerol (10-20%) in buffers; test different detergent:protein ratios
Lack of functional assaysUnknown substrate/activityDevelop hypothesis-based screening approaches; use genetic context for functional predictions
Structural instabilityDetergent-induced conformational changesScreen lipid additives; consider nanodiscs or SMALPs for stabilization

Additionally, when working with YteJ specifically:

  • Optimize membrane extraction:

    • Test different detergents systematically

    • Consider native nanodiscs for maintaining the native lipid environment

  • Address functional characterization:

    • Utilize genetic code expansion for site-specific labeling

    • Employ suppressor screens to identify genetic interactions

  • Improve yield and purity:

    • Consider chaperone co-expression to improve folding

    • Optimize B. subtilis strains through approaches like those used for recombinant protein production enhancement

How can I design experiments to investigate potential interactions between YteJ and other membrane proteins?

To investigate YteJ interactions with other membrane proteins:

  • Genetic Interaction Mapping:

    • Create a ΔyteJ strain and screen for synthetic lethality/sickness with other membrane protein mutations

    • Perform suppressor screens to identify genes that compensate for yteJ deletion

    • Analyze epistasis relationships through double knockout analyses

  • Physical Interaction Studies:

    • In vivo crosslinking using non-standard amino acids incorporated through genetic code expansion

    • Co-immunoprecipitation with epitope-tagged YteJ

    • Split reporter assays (e.g., BACTH system) adapted for membrane proteins

    • Proximity-based labeling using BioID or APEX2 fusions

  • Localization Studies:

    • Fluorescent protein fusions to determine co-localization patterns

    • Super-resolution microscopy to visualize nanoscale proximity

    • Time-lapse imaging to detect dynamic interactions

  • Functional Coupling Analysis:

    • Measure transport activities in presence/absence of potential partner proteins

    • Assess changes in substrate specificity when co-expressed with other transporters

    • Similar to approaches used for characterizing AraE protein transport function

  • Structural Analysis:

    • Develop a structural model based on crosslinking constraints

    • Use genetic code expansion to incorporate photocrosslinking amino acids at specific positions

    • Apply mass spectrometry to identify crosslinked residues and interaction interfaces

How does YteJ potentially fit into the broader membrane proteome of B. subtilis?

Understanding YteJ's role in the broader membrane proteome requires multi-layered analysis:

  • Genomic Context Analysis:

    • Examine genes in the same operon or genetic neighborhood as yteJ

    • Analyze conservation patterns across related Bacillus species

    • Identify potential regulators through promoter sequence analysis

  • Transcriptomic Integration:

    • Analyze co-expression patterns with other membrane proteins

    • Identify conditions that modulate yteJ expression

    • Construct regulatory networks involving yteJ

  • Proteomic Landscape Mapping:

    • Quantitative membrane proteomics under various conditions

    • Comparison of membrane protein abundance in wild-type vs. ΔyteJ strains

    • Identification of proteins with altered membrane association in yteJ mutants

  • Metabolic Network Integration:

    • If YteJ functions as a transporter, determine its substrate specificities

    • Analyze metabolic flux changes in ΔyteJ strains

    • Similar to approaches used for characterizing the role of AraE in xylose metabolism

  • Membrane Organization:

    • Investigate YteJ localization within membrane microdomains

    • Examine potential interactions with the cell wall synthesis machinery

    • Consider applications of non-standard amino acid incorporation for visualization

What advanced approaches can I use to determine the role of YteJ in stress responses or environmental adaptations?

To investigate YteJ's role in stress responses:

  • Stress Response Profiling:

    • Compare growth and survival of wild-type and ΔyteJ strains under various stresses:

      • Osmotic stress (varying NaCl concentrations)

      • pH stress (acidic and alkaline conditions)

      • Nutrient limitation

      • Antimicrobial compounds

  • Transcriptional Response Analysis:

    • Perform RNA-seq to compare global transcriptional responses to stress

    • Identify differentially regulated pathways in ΔyteJ strains

    • Construct regulatory networks affected by YteJ deletion

  • Membrane Integrity Assessment:

    • Measure membrane potential changes using fluorescent probes

    • Assess membrane permeability under stress conditions

    • Examine lipid composition alterations in response to stress

  • Phenotypic Microarray Analysis:

    • Use Biolog phenotypic microarrays to screen hundreds of growth conditions

    • Identify specific conditions where YteJ provides adaptive advantages

    • Develop targeted hypotheses based on phenotypic signatures

  • Evolutionary Adaptation Studies:

    • Perform experimental evolution under specific stresses

    • Compare adaptive trajectories of wild-type and ΔyteJ strains

    • Identify compensatory mutations that arise in ΔyteJ backgrounds

    • This approach is conceptually similar to the experimental evolution studies conducted with B. subtilis under different selective pressures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.