Recombinant Bacillus subtilis Uncharacterized membrane protein ytpI (ytpI)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

AttributeDescriptionSource
Gene NameytpI
Uniprot IDO34922
Chromosome LocationNC_000964.3 (2996980..2997282)
Protein LengthFull-length or partial (expression-dependent)
Protein TagsN-terminal His-tag (commonly used for purification)
Expression HostsE. coli, Yeast, or Baculovirus/mammalian systems
Purity≥80–85% by SDS-PAGE

Key Observations:

  • The protein lacks functional annotations in public databases, though its membrane localization implies involvement in transmembrane processes.

  • Commercial recombinant versions are produced with His-tags for affinity chromatography, enabling scalable purification .

Production and Biochemical Features

ParameterDetailsSource
Expression SystemsE. coli is the primary host; alternative systems (e.g., yeast) are available
Purification MethodsAffinity chromatography (His-tag), SDS-PAGE validation
Storage Conditions-20°C to -80°C (long-term), 4°C (short-term)
Endotoxin Levels<1.0 EU/μg (low-endotoxin options available)
Buffer CompositionPBS buffer or Tris-based buffer with 50% glycerol

Technical Notes:

  • Small volumes may adhere to vial seals during shipping; centrifugation is recommended to dislodge trapped liquid .

  • Repeated freeze-thaw cycles are discouraged to preserve protein stability .

Research Gaps and Future Directions

Despite its availability, ytpI remains understudied:

  1. Functional Elucidation: No published studies directly link ytpI to specific biochemical pathways. Hypothesized roles include membrane trafficking or stress response, but experimental validation is lacking.

  2. Structural Insights: No 3D structures are reported in ModBase or similar databases . X-ray crystallography or cryo-EM could resolve its conformational dynamics.

  3. Interaction Networks: Potential partners in B. subtilis membrane complexes (e.g., Sec translocases, HtrA proteases) remain unexplored .

Recommendations:

  • Targeted Mutagenesis: Site-directed mutagenesis (e.g., cysteine-to-serine substitutions) could identify catalytic residues, as demonstrated for related proteins like YtpP .

  • Oxidative Stress Studies: Given B. subtilis’ reliance on CoA-thiol redox systems , ytpI’s role in mitigating oxidative damage warrants investigation.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
ytpI; BSU29260; Uncharacterized membrane protein YtpI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ytpI
Target Protein Sequence
MLVLVFLIGLSACFYVYYKVKGVRAKPSLAKEICSAKSSMALGSLVLFYGLNQMILFHSV LTLVIGGIFIVIGAGSAWAGYKAFRHYNPLHAKEAERDHA
Uniprot No.

Target Background

Database Links

KEGG: bsu:BSU29260

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ytpI and what do we currently know about this protein?

ytpI is an uncharacterized membrane protein from Bacillus subtilis subsp. subtilis str. 168 (UniProt ID: O34922, Gene ID: 937370). It is classified as a hypothetical protein, meaning its function has not been fully elucidated through experimental validation. As a membrane protein, it is likely involved in cellular processes related to membrane integrity, transport, or signaling pathways within B. subtilis, though specific functions remain to be characterized through targeted research approaches .

How does ytpI compare with other characterized membrane proteins in Bacillus subtilis?

While ytpI remains uncharacterized, B. subtilis has numerous well-studied membrane proteins involved in various cellular processes. Unlike characterized proteins such as YtpP (thioredoxin-like protein) which has been shown to play a role in protein deCoAlation and oxidative stress response, ytpI's function remains to be elucidated . Comparative sequence analysis with other membrane proteins may reveal conserved domains that could suggest functional roles. Researchers should consider employing structural prediction tools and phylogenetic analysis to place ytpI within the context of other B. subtilis membrane proteins.

What expression systems are available for recombinant ytpI production?

Recombinant B. subtilis ytpI can be expressed in both E. coli and yeast expression systems. The choice between these systems depends on research requirements and downstream applications. E. coli systems typically offer higher protein yields and simpler cultivation requirements, while yeast expression may provide more appropriate post-translational modifications for membrane proteins . Both systems can accommodate His-tagged versions of the protein, facilitating purification through affinity chromatography techniques.

Expression SystemAdvantagesChallengesTag Options
E. coliHigh yield, economical, rapid growthPotential inclusion body formation, limited post-translational modificationsHis-tag (N-terminal)
YeastBetter membrane protein folding, eukaryotic post-translational modificationsLower yield, longer production timeHis-tag (N-terminal)

What purification methods are most effective for recombinant ytpI?

For His-tagged recombinant ytpI, immobilized metal affinity chromatography (IMAC) represents the primary purification approach. The protocol should be optimized considering ytpI's membrane protein nature, which presents unique challenges. A recommended purification workflow includes:

  • Cell lysis using mechanical disruption or detergent-based methods

  • Membrane fraction isolation through ultracentrifugation

  • Membrane protein solubilization using appropriate detergents (e.g., n-dodecyl β-D-maltoside)

  • IMAC purification using Ni-NTA or similar matrices

  • Size exclusion chromatography for additional purity

The final purified protein typically achieves >80% purity as assessed by SDS-PAGE . Storage conditions should include PBS buffer with appropriate detergent concentrations to maintain protein stability.

How can researchers measure the quality and stability of purified ytpI protein?

Assessing the quality and stability of purified ytpI involves multiple complementary approaches:

  • Purity assessment via SDS-PAGE and Western blotting with anti-His antibodies

  • Secondary structure analysis using circular dichroism spectroscopy

  • Thermal stability assessment through differential scanning fluorimetry

  • Size and aggregation state determination using dynamic light scattering

  • Functionality assessment through reconstitution into liposomes or nanodiscs

For long-term storage, the protein should be maintained at -20°C to -80°C in a stabilizing buffer containing appropriate detergents and potentially glycerol as a cryoprotectant .

What experimental approaches can determine potential functions of ytpI?

Since ytpI is uncharacterized, multiple complementary approaches should be employed to elucidate its function:

  • Genetic approaches: Gene knockout/knockdown studies to observe phenotypic changes in B. subtilis, complemented by transcriptomic analysis to identify affected pathways

  • Protein interaction studies: Pull-down assays, bacterial two-hybrid systems, or proximity labeling to identify interaction partners

  • Localization studies: Fluorescent protein tagging to determine subcellular localization within the bacterial membrane

  • Structural biology: Cryo-EM or X-ray crystallography to determine protein structure

  • Comparative genomics: Analysis of ytpI conservation across related species to infer evolutionary importance

These approaches should be integrated within a comprehensive research program that accounts for B. subtilis physiology and cellular processes such as stress response, sporulation, and basic metabolic functions.

How might ytpI relate to known stress response pathways in Bacillus subtilis?

While ytpI's specific role remains undefined, B. subtilis employs various membrane proteins in stress response pathways. Based on knowledge of B. subtilis biology, researchers should investigate ytpI's potential involvement in:

  • Oxidative stress response: As demonstrated with other B. subtilis proteins (e.g., YtpP and TrxA), membrane proteins can play crucial roles in managing oxidative damage

  • Cell envelope stress response: Examine potential interactions with systems monitoring membrane integrity

  • Nutrient limitation responses: Investigate expression changes under different nutrient conditions

  • Sporulation signaling: Determine if ytpI expression correlates with sporulation stages

Experimental designs should include exposure to various stress conditions (oxidative, osmotic, temperature) followed by assessment of ytpI expression levels and localization patterns.

How can network component analysis be applied to understand ytpI's role in the B. subtilis regulatory network?

Network component analysis (NCA) represents a powerful approach to understanding ytpI's position within the B. subtilis transcriptional regulatory network. Researchers can apply NCA using the following methodology:

  • Collect transcriptomic data across multiple experimental conditions, including various stress responses and growth phases

  • Incorporate prior knowledge of B. subtilis regulatory interactions from databases like SubtiWiki

  • Apply NCA algorithms to simultaneously estimate transcription factor activities and regulatory interactions

  • Use model selection approaches to identify novel regulatory connections involving ytpI

  • Validate predicted interactions through targeted experiments such as ChIP-seq or bacterial one-hybrid assays

This approach has successfully expanded our understanding of the B. subtilis regulatory network, identifying thousands of novel regulatory interactions with high validation rates . For ytpI specifically, this could reveal its position within regulatory hierarchies and suggest functional roles based on co-regulated genes.

What approaches can be used to study ytpI's potential role in protein CoAlation and deCoAlation mechanisms?

Recent discoveries regarding protein CoAlation as a protective mechanism against oxidative stress provide an interesting framework for investigating ytpI's potential functions. Researchers could examine:

  • Whether ytpI undergoes CoAlation under oxidative stress conditions using anti-CoA antibodies

  • If ytpI interacts with known CoAlation/deCoAlation enzymes like YtpP or TrxA

  • Whether ytpI knockouts affect the cellular CoAlation profile under stress conditions

The methodology should include ELISA-based deCoAlation assays as described for YtpP and TrxA characterization, combined with mass spectrometry analysis to identify potential CoAlation sites on ytpI . If involved in this pathway, ytpI could represent a new player in B. subtilis oxidative stress management.

What are common challenges in expressing membrane proteins like ytpI and how can they be addressed?

Membrane protein expression presents several unique challenges:

ChallengePotential SolutionImplementation Details
Low expression levelsOptimize codon usage, use strong promotersDesign custom gene constructs optimized for expression host
Protein misfoldingLower induction temperature, use specialized hostsExpress at 16-25°C, consider C41/C43 E. coli strains
Toxicity to host cellsUse tightly controlled induction systemsIPTG-inducible systems with tunable expression levels
Inclusion body formationFusion with solubility-enhancing tagsMBP, SUMO, or Thioredoxin fusion strategies
Difficult solubilizationScreen multiple detergentsSystematic testing of detergent types and concentrations

For ytpI specifically, researchers should consider creating a series of truncated constructs to identify domains that express more efficiently while retaining key functional elements, similar to approaches used for other B. subtilis membrane proteins .

How should researchers analyze contradictory data regarding ytpI function?

When faced with conflicting experimental results regarding ytpI function, researchers should implement a systematic troubleshooting approach:

  • Examine protein quality: Verify that different experiments used comparable protein preparations with proper folding and stability

  • Control for experimental conditions: Standardize buffer compositions, temperature, and pH across experiments

  • Consider physiological context: B. subtilis proteins may function differently depending on growth phase and environmental conditions

  • Integrate multiple data types: Combine genetic, biochemical, and structural data to develop a comprehensive model

  • Apply Bayesian approaches: Use probabilistic frameworks to weigh evidence from contradictory experiments

Additionally, researchers should consider that as an uncharacterized protein, ytpI might have multiple functions depending on cellular context, similar to the dual functions observed for some B. subtilis proteins in the regulatory network .

How might systems biology approaches advance our understanding of ytpI function?

Systems biology approaches offer powerful frameworks for characterizing uncharacterized proteins like ytpI:

  • Genome-scale metabolic modeling: Incorporate ytpI into existing B. subtilis metabolic models to predict functional roles

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics data to place ytpI in cellular pathways

  • Network inference: Apply advanced algorithms like those used in the B. subtilis global transcriptional regulatory network studies to identify ytpI's position in regulatory hierarchies

  • Evolutionary systems biology: Compare ytpI across related species to understand its evolutionary importance

These approaches can generate testable hypotheses about ytpI function that traditional reductionist approaches might miss, especially for proteins with subtle phenotypes or redundant functions.

What are the implications of ytpI research for understanding pathogenic Bacillus species?

B. subtilis serves as a model organism for pathogenic members of the Bacillus genus, including B. anthracis (causative agent of anthrax) and B. cereus (causative agent of food poisoning) . Understanding ytpI in B. subtilis could have broader implications:

  • If ytpI homologs exist in pathogenic species, insights from B. subtilis research could inform understanding of virulence mechanisms

  • Membrane proteins often play critical roles in host-pathogen interactions and environmental adaptation

  • If ytpI is involved in stress response, similar mechanisms might contribute to pathogen survival during infection

  • Novel antimicrobial strategies could potentially target conserved membrane proteins identified through comparative studies

Researchers should perform comparative genomics analyses to identify ytpI homologs in pathogenic Bacillus species and assess conservation of sequence, structure, and genomic context as a foundation for translational research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.