Recombinant Bacillus subtilis Uncharacterized membrane protein yttA(yttA) is available in a size of 50 ug, though other sizes can be requested . It is a recombinant protein derived from Bacillus subtilis (strain 168) .
UniProt Accession Number The UniProt accession number for this protein is Q795Q5 .
Amino Acid Sequence The full amino acid sequence of the protein is :
MEMVLAFLGFLACLIALGYGLYHLVRYVLKKEKRFSKRLFWPLFIGGLVLLFTGAALAEPDTAAANAEKKYSALNAEYKNLTKEHEELEKEYKSVSSEAKKLKDNKEDQDKLEKLKNENSDLKKTQKSLKAEIKELQENQKQLKEDAKTAKAENETLRQDKTKLENQLKETESQTASSHEDTGSSSNNTSKSDETKTADKAEGCNIKGSRNGIYHTPGSTYYDRTTDPAEMFCSVEEAEAGYRAPKR
Gene and Protein Names The recommended protein name is Uncharacterized membrane protein yttA, encoded by the gene yttA (Ordered Locus Names: BSU30360) . The expression region spans amino acids 1-248, representing the full-length protein .
The protein's function is currently uncharacterized, limiting specific applications . Research indicates that B. subtilis can elicit immune responses in mice, suggesting potential applications in vaccine development, although this is not directly linked to yttA .
B. subtilis expression systems commonly utilize chemical inducers such as IPTG, sucrose, mannose, xylose, maltose, and starch to control protein production . These systems enhance the efficiency and reduce the costs of producing biotechnologically important proteins .
KEGG: bsu:BSU30360
STRING: 224308.Bsubs1_010100016531
The most common expression system for producing recombinant YttA protein is Escherichia coli. As documented in the literature, full-length Bacillus subtilis YttA protein can be successfully expressed with an N-terminal His-tag in E. coli expression systems . This approach facilitates purification using affinity chromatography.
For optimal expression:
The full coding sequence (1-248aa) is typically cloned into an expression vector containing a His-tag
Expression is induced under controlled conditions
The recombinant protein is purified using nickel affinity chromatography
The final product is often prepared as a lyophilized powder with > 90% purity as determined by SDS-PAGE
For storage and handling, the purified protein is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added as a cryoprotectant for long-term storage at -20°C to -80°C . Repeated freeze-thaw cycles should be avoided to maintain protein integrity.
The yttA gene in Bacillus subtilis is subject to negative regulation by TnrA, a global transcriptional regulator that responds to nitrogen availability . This regulatory relationship places yttA within the broader context of the nitrogen regulatory network in B. subtilis.
Key aspects of yttA regulation include:
TnrA-dependent repression: TnrA binds to specific DNA sequences in the promoter region of yttA, repressing its transcription under certain nitrogen conditions
Integration within the nitrogen regulon: yttA is part of a suite of genes regulated by TnrA, including well-studied targets like nrgAB and gltAB (which are positively regulated) and others that are negatively regulated such as ywlFG, yodF, and alsT
Potential response to environmental nitrogen signals: As part of the TnrA regulon, yttA expression likely fluctuates in response to cellular nitrogen status
This regulatory pattern suggests that YttA function may be particularly relevant under specific nitrogen availability conditions, potentially contributing to adaptation mechanisms in B. subtilis.
Characterizing uncharacterized membrane proteins like YttA requires a multi-faceted approach combining structural, functional, and interaction studies. Based on current methodologies in protein science:
Structural Characterization:
Cryo-electron microscopy (Cryo-EM): Particularly valuable for membrane proteins that resist crystallization
X-ray crystallography: If sufficiently pure, stable crystals can be obtained
NMR spectroscopy: For obtaining dynamic structural information in membrane-mimetic environments
Computational modeling: Using homology modeling and molecular dynamics simulations to predict structure based on sequence data
Functional Characterization:
Gene knockout/knockdown studies: To observe phenotypic changes in B. subtilis lacking functional yttA
Complementation assays: Reintroducing yttA to rescue phenotypes
Site-directed mutagenesis: To identify critical residues for function
Reporter fusion constructs: To monitor expression patterns under various conditions
Interaction Studies:
Bacterial two-hybrid systems: To identify protein interaction partners
Co-immunoprecipitation coupled with mass spectrometry: To identify protein complexes
Crosslinking studies: To capture transient interactions
An integrated experimental design might involve:
| Experimental Approach | Application to YttA | Expected Outcome |
|---|---|---|
| Proteomic profiling | Compare wild-type vs. yttA-knockout strains | Identification of affected pathways |
| Metabolomic analysis | Analyze changes in nitrogen-related metabolites | Insight into metabolic role |
| Membrane topology mapping | Using PhoA/LacZ fusion reporters | Determination of transmembrane domains and orientation |
| Fluorescent protein tagging | Subcellular localization studies | Spatial organization within the cell |
| Transcriptomics | RNA-seq analysis under different conditions | Regulatory networks and co-expressed genes |
Considering that YttA is regulated by TnrA, studies should be performed under varying nitrogen availability conditions to capture condition-specific functions .
The negative regulation of yttA by TnrA represents an intriguing component of the complex nitrogen regulatory network in B. subtilis. TnrA is a global transcriptional regulator that controls numerous genes involved in nitrogen metabolism:
TnrA regulatory mechanisms:
TnrA typically activates genes involved in nitrogen scavenging and utilization during nitrogen limitation
It represses genes involved in nitrogen assimilation when preferred nitrogen sources are available
YttA in the context of the TnrA regulon:
Functional implications:
The negative regulation pattern suggests YttA may be involved in processes that are advantageous when nitrogen is abundant
This could include membrane transport functions related to nitrogen-containing compounds or cellular responses to nitrogen sufficiency
The positioning of yttA in this regulatory network suggests it may play a role in fine-tuning cellular responses to changing nitrogen availability. Its precise function might represent a novel aspect of nitrogen homeostasis in B. subtilis that has not been fully characterized in the established nitrogen regulatory pathways.
Investigating membrane protein topology and function requires specialized methodologies that address the challenges posed by the hydrophobic nature and membrane environment of these proteins:
Topology Determination Methods:
Fusion protein approaches:
PhoA/LacZ fusion analysis: Creating systematic fusions at different positions to determine cytoplasmic vs. periplasmic orientation
GFP-based reporters: Fluorescence patterns differ based on cellular localization
Cysteine accessibility methods:
SCAM (Substituted Cysteine Accessibility Method): Introduces cysteine residues at various positions and tests their accessibility to membrane-impermeable reagents
Proteolytic digestion:
Limited proteolysis combined with mass spectrometry to identify exposed regions
Functional Analysis Approaches:
Transport assays:
If YttA functions as a transporter, radiolabeled substrate uptake/export measurements
Membrane vesicle-based transport studies
Electrophysiological methods:
Patch clamp analysis if channel activity is suspected
Reconstitution into artificial membranes or liposomes
Interaction mapping:
Identifying interaction partners using pull-down assays optimized for membrane proteins
Blue native PAGE to identify native complexes
Experimental Design Considerations:
| Method | Technical Approach | Application to YttA Research |
|---|---|---|
| Detergent screening | Systematic testing of detergents for optimal solubilization | Identifying conditions for structural studies |
| Nanodiscs/liposome reconstitution | Incorporating purified YttA into membrane mimetics | Creating functional assay systems |
| Crosslinking coupled with MS | Using membrane-permeable crosslinkers | Identifying proximal proteins in native environment |
| FRET analysis | Fluorescent labeling at specific sites | Monitoring conformational changes |
| MD simulations | Computational modeling in membrane environment | Predicting structure-function relationships |
When designing experiments for YttA, special consideration should be given to the nitrogen-dependent regulation by TnrA . Functional assays should be performed under both nitrogen-limited and nitrogen-excess conditions to detect potential condition-specific activities.
Proteomics analysis of membrane proteins requires specialized methodologies to overcome challenges related to hydrophobicity, low abundance, and the complexity of membrane-associated protein complexes:
Sample Preparation Optimization:
Membrane enrichment strategies:
Differential centrifugation to isolate membrane fractions
Density gradient separation for membrane purity
Two-phase partitioning systems for plasma membrane enrichment
Solubilization approaches:
Detergent screening: Identify optimal detergents that maintain native conformation
Detergent-free methods: Nanodiscs, styrene-maleic acid copolymer (SMA) extraction
Phase-transfer surfactants for improved digestion efficiency
Mass Spectrometry Considerations:
Digestion protocols:
Multiple proteases beyond trypsin (e.g., chymotrypsin, Lys-C, Glu-C) to improve sequence coverage
In-solution vs. in-gel digestion optimization
Separation techniques:
High-pH reversed-phase fractionation prior to LC-MS/MS
Extended LC gradients for complex membrane samples
Acquisition strategies:
Data-independent acquisition (DIA) for comprehensive detection
Targeted approaches (PRM/MRM) for specific protein quantification
Data Analysis Approaches:
The relative dynamic range (RDR) concept described in proteomics modeling is particularly relevant for membrane proteins like YttA that might be present at low abundance. Experimental designs should aim to achieve optimal RDR values by implementing appropriate separation techniques and detection methodologies.
| Parameter | Standard Approach | Optimized Approach for Membrane Proteins |
|---|---|---|
| Protein Extraction | Standard lysis buffers | Specialized membrane protein extraction buffers |
| Digestion | Standard overnight trypsin digestion | Multiple proteases, extended digestion times |
| Fractionation | Basic RP fractionation | Specialized membrane protein fractionation |
| MS Acquisition | DDA-based analysis | Combined DDA/DIA approaches |
| Data Analysis | Standard search parameters | Membrane protein-optimized search algorithms |
Computational modeling of experimental design, as described in source , can be valuable for optimizing proteomics approaches for YttA analysis. This modeling can help achieve better protein separation, improved detection limits, and enhanced MS dynamic range .
The negative regulation of yttA by TnrA provides valuable insights into both bacterial physiology and potential biotechnological applications:
Physiological Implications:
Nitrogen-responsive membrane adaptation:
YttA expression increases when nitrogen is abundant (when TnrA is inactive)
This suggests YttA may be involved in membrane adaptations specific to nitrogen-replete conditions
Potentially involved in transport or sensing functions related to nitrogen utilization
Integration with stress responses:
Metabolic coordination:
The co-regulation with other TnrA targets suggests coordination with central nitrogen metabolism
May be involved in balancing nitrogen assimilation with other cellular processes
Biotechnological Potential:
Bioproduction applications:
Biomarker development:
YttA expression patterns could serve as a biomarker for nitrogen status in B. subtilis
Potential applications in monitoring industrial fermentation processes
Synthetic biology tools:
The promoter region containing TnrA-binding sites could be used to develop nitrogen-responsive genetic circuits
Engineering YttA for altered function might enable novel cellular responses to nitrogen availability
Understanding the precise function of YttA in the context of TnrA regulation presents an opportunity to develop new strategies for modulating bacterial responses to changing nitrogen availability, with potential applications in industrial biotechnology where B. subtilis serves as a key production host .