Recombinant Bacillus subtilis Uncharacterized membrane protein yttA (yttA)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bacillus subtilis Uncharacterized membrane protein yttA(yttA) is available in a size of 50 ug, though other sizes can be requested . It is a recombinant protein derived from Bacillus subtilis (strain 168) .

UniProt Accession Number The UniProt accession number for this protein is Q795Q5 .

Amino Acid Sequence The full amino acid sequence of the protein is :

MEMVLAFLGFLACLIALGYGLYHLVRYVLKKEKRFSKRLFWPLFIGGLVLLFTGAALAEPDTAAANAEKKYSALNAEYKNLTKEHEELEKEYKSVSSEAKKLKDNKEDQDKLEKLKNENSDLKKTQKSLKAEIKELQENQKQLKEDAKTAKAENETLRQDKTKLENQLKETESQTASSHEDTGSSSNNTSKSDETKTADKAEGCNIKGSRNGIYHTPGSTYYDRTTDPAEMFCSVEEAEAGYRAPKR

Gene and Protein Names The recommended protein name is Uncharacterized membrane protein yttA, encoded by the gene yttA (Ordered Locus Names: BSU30360) . The expression region spans amino acids 1-248, representing the full-length protein .

Functional Insights

The protein's function is currently uncharacterized, limiting specific applications . Research indicates that B. subtilis can elicit immune responses in mice, suggesting potential applications in vaccine development, although this is not directly linked to yttA .

Expression and Production

B. subtilis expression systems commonly utilize chemical inducers such as IPTG, sucrose, mannose, xylose, maltose, and starch to control protein production . These systems enhance the efficiency and reduce the costs of producing biotechnologically important proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your convenience.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yttA; BSU30360; Uncharacterized membrane protein YttA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yttA
Target Protein Sequence
MEMVLAFLGFLACLIALGYGLYHLVRYVLKKEKRFSKRLFWPLFIGGLVLLFTGAALAEP DTAAANAEKKYSALNAEYKNLTKEHEELEKEYKSVSSEAKKLKDNKEDQDKLEKLKNENS DLKKTQKSLKAEIKELQENQKQLKEDAKTAKAENETLRQDKTKLENQLKETESQTASSHE DTGSSSNNTSKSDETKTADKAEGCNIKGSRNGIYHTPGSTYYDRTTDPAEMFCSVEEAEA AGYRAPKR
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used for producing recombinant YttA protein?

The most common expression system for producing recombinant YttA protein is Escherichia coli. As documented in the literature, full-length Bacillus subtilis YttA protein can be successfully expressed with an N-terminal His-tag in E. coli expression systems . This approach facilitates purification using affinity chromatography.

For optimal expression:

  • The full coding sequence (1-248aa) is typically cloned into an expression vector containing a His-tag

  • Expression is induced under controlled conditions

  • The recombinant protein is purified using nickel affinity chromatography

  • The final product is often prepared as a lyophilized powder with > 90% purity as determined by SDS-PAGE

For storage and handling, the purified protein is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added as a cryoprotectant for long-term storage at -20°C to -80°C . Repeated freeze-thaw cycles should be avoided to maintain protein integrity.

How is the yttA gene regulated in Bacillus subtilis?

The yttA gene in Bacillus subtilis is subject to negative regulation by TnrA, a global transcriptional regulator that responds to nitrogen availability . This regulatory relationship places yttA within the broader context of the nitrogen regulatory network in B. subtilis.

Key aspects of yttA regulation include:

  • TnrA-dependent repression: TnrA binds to specific DNA sequences in the promoter region of yttA, repressing its transcription under certain nitrogen conditions

  • Integration within the nitrogen regulon: yttA is part of a suite of genes regulated by TnrA, including well-studied targets like nrgAB and gltAB (which are positively regulated) and others that are negatively regulated such as ywlFG, yodF, and alsT

  • Potential response to environmental nitrogen signals: As part of the TnrA regulon, yttA expression likely fluctuates in response to cellular nitrogen status

This regulatory pattern suggests that YttA function may be particularly relevant under specific nitrogen availability conditions, potentially contributing to adaptation mechanisms in B. subtilis.

What experimental approaches are most effective for characterizing uncharacterized membrane proteins like YttA?

Characterizing uncharacterized membrane proteins like YttA requires a multi-faceted approach combining structural, functional, and interaction studies. Based on current methodologies in protein science:

Structural Characterization:

  • Cryo-electron microscopy (Cryo-EM): Particularly valuable for membrane proteins that resist crystallization

  • X-ray crystallography: If sufficiently pure, stable crystals can be obtained

  • NMR spectroscopy: For obtaining dynamic structural information in membrane-mimetic environments

  • Computational modeling: Using homology modeling and molecular dynamics simulations to predict structure based on sequence data

Functional Characterization:

  • Gene knockout/knockdown studies: To observe phenotypic changes in B. subtilis lacking functional yttA

  • Complementation assays: Reintroducing yttA to rescue phenotypes

  • Site-directed mutagenesis: To identify critical residues for function

  • Reporter fusion constructs: To monitor expression patterns under various conditions

Interaction Studies:

  • Bacterial two-hybrid systems: To identify protein interaction partners

  • Co-immunoprecipitation coupled with mass spectrometry: To identify protein complexes

  • Crosslinking studies: To capture transient interactions

An integrated experimental design might involve:

Experimental ApproachApplication to YttAExpected Outcome
Proteomic profilingCompare wild-type vs. yttA-knockout strainsIdentification of affected pathways
Metabolomic analysisAnalyze changes in nitrogen-related metabolitesInsight into metabolic role
Membrane topology mappingUsing PhoA/LacZ fusion reportersDetermination of transmembrane domains and orientation
Fluorescent protein taggingSubcellular localization studiesSpatial organization within the cell
TranscriptomicsRNA-seq analysis under different conditionsRegulatory networks and co-expressed genes

Considering that YttA is regulated by TnrA, studies should be performed under varying nitrogen availability conditions to capture condition-specific functions .

How does the TnrA regulation of YttA fit into the broader nitrogen regulation network in Bacillus subtilis?

The negative regulation of yttA by TnrA represents an intriguing component of the complex nitrogen regulatory network in B. subtilis. TnrA is a global transcriptional regulator that controls numerous genes involved in nitrogen metabolism:

  • TnrA regulatory mechanisms:

    • TnrA typically activates genes involved in nitrogen scavenging and utilization during nitrogen limitation

    • It represses genes involved in nitrogen assimilation when preferred nitrogen sources are available

  • YttA in the context of the TnrA regulon:

    • YttA belongs to a subset of genes negatively regulated by TnrA, alongside ywlFG, yodF, and alsT

    • This contrasts with positively regulated TnrA targets such as nrgAB (ammonium transport) and gltAB (glutamate synthesis)

  • Functional implications:

    • The negative regulation pattern suggests YttA may be involved in processes that are advantageous when nitrogen is abundant

    • This could include membrane transport functions related to nitrogen-containing compounds or cellular responses to nitrogen sufficiency

The positioning of yttA in this regulatory network suggests it may play a role in fine-tuning cellular responses to changing nitrogen availability. Its precise function might represent a novel aspect of nitrogen homeostasis in B. subtilis that has not been fully characterized in the established nitrogen regulatory pathways.

What methodological approaches should be employed for studying membrane protein topology and function like YttA?

Investigating membrane protein topology and function requires specialized methodologies that address the challenges posed by the hydrophobic nature and membrane environment of these proteins:

Topology Determination Methods:

  • Fusion protein approaches:

    • PhoA/LacZ fusion analysis: Creating systematic fusions at different positions to determine cytoplasmic vs. periplasmic orientation

    • GFP-based reporters: Fluorescence patterns differ based on cellular localization

  • Cysteine accessibility methods:

    • SCAM (Substituted Cysteine Accessibility Method): Introduces cysteine residues at various positions and tests their accessibility to membrane-impermeable reagents

  • Proteolytic digestion:

    • Limited proteolysis combined with mass spectrometry to identify exposed regions

Functional Analysis Approaches:

  • Transport assays:

    • If YttA functions as a transporter, radiolabeled substrate uptake/export measurements

    • Membrane vesicle-based transport studies

  • Electrophysiological methods:

    • Patch clamp analysis if channel activity is suspected

    • Reconstitution into artificial membranes or liposomes

  • Interaction mapping:

    • Identifying interaction partners using pull-down assays optimized for membrane proteins

    • Blue native PAGE to identify native complexes

Experimental Design Considerations:

MethodTechnical ApproachApplication to YttA Research
Detergent screeningSystematic testing of detergents for optimal solubilizationIdentifying conditions for structural studies
Nanodiscs/liposome reconstitutionIncorporating purified YttA into membrane mimeticsCreating functional assay systems
Crosslinking coupled with MSUsing membrane-permeable crosslinkersIdentifying proximal proteins in native environment
FRET analysisFluorescent labeling at specific sitesMonitoring conformational changes
MD simulationsComputational modeling in membrane environmentPredicting structure-function relationships

When designing experiments for YttA, special consideration should be given to the nitrogen-dependent regulation by TnrA . Functional assays should be performed under both nitrogen-limited and nitrogen-excess conditions to detect potential condition-specific activities.

How can proteomics approaches be optimized for studying membrane proteins like YttA?

Proteomics analysis of membrane proteins requires specialized methodologies to overcome challenges related to hydrophobicity, low abundance, and the complexity of membrane-associated protein complexes:

Sample Preparation Optimization:

  • Membrane enrichment strategies:

    • Differential centrifugation to isolate membrane fractions

    • Density gradient separation for membrane purity

    • Two-phase partitioning systems for plasma membrane enrichment

  • Solubilization approaches:

    • Detergent screening: Identify optimal detergents that maintain native conformation

    • Detergent-free methods: Nanodiscs, styrene-maleic acid copolymer (SMA) extraction

    • Phase-transfer surfactants for improved digestion efficiency

Mass Spectrometry Considerations:

  • Digestion protocols:

    • Multiple proteases beyond trypsin (e.g., chymotrypsin, Lys-C, Glu-C) to improve sequence coverage

    • In-solution vs. in-gel digestion optimization

  • Separation techniques:

    • High-pH reversed-phase fractionation prior to LC-MS/MS

    • Extended LC gradients for complex membrane samples

  • Acquisition strategies:

    • Data-independent acquisition (DIA) for comprehensive detection

    • Targeted approaches (PRM/MRM) for specific protein quantification

Data Analysis Approaches:

The relative dynamic range (RDR) concept described in proteomics modeling is particularly relevant for membrane proteins like YttA that might be present at low abundance. Experimental designs should aim to achieve optimal RDR values by implementing appropriate separation techniques and detection methodologies.

ParameterStandard ApproachOptimized Approach for Membrane Proteins
Protein ExtractionStandard lysis buffersSpecialized membrane protein extraction buffers
DigestionStandard overnight trypsin digestionMultiple proteases, extended digestion times
FractionationBasic RP fractionationSpecialized membrane protein fractionation
MS AcquisitionDDA-based analysisCombined DDA/DIA approaches
Data AnalysisStandard search parametersMembrane protein-optimized search algorithms

Computational modeling of experimental design, as described in source , can be valuable for optimizing proteomics approaches for YttA analysis. This modeling can help achieve better protein separation, improved detection limits, and enhanced MS dynamic range .

What are the implications of YttA's negative regulation by TnrA for bacterial physiology and potential biotechnological applications?

The negative regulation of yttA by TnrA provides valuable insights into both bacterial physiology and potential biotechnological applications:

Physiological Implications:

  • Nitrogen-responsive membrane adaptation:

    • YttA expression increases when nitrogen is abundant (when TnrA is inactive)

    • This suggests YttA may be involved in membrane adaptations specific to nitrogen-replete conditions

    • Potentially involved in transport or sensing functions related to nitrogen utilization

  • Integration with stress responses:

    • In B. subtilis, membrane proteins often participate in stress response mechanisms

    • The connection to nitrogen regulation may indicate a role in coordinating stress responses with nutrient availability

    • Could function similar to how CssRS system responds to secretion stress

  • Metabolic coordination:

    • The co-regulation with other TnrA targets suggests coordination with central nitrogen metabolism

    • May be involved in balancing nitrogen assimilation with other cellular processes

Biotechnological Potential:

  • Bioproduction applications:

    • Understanding YttA function could contribute to optimizing B. subtilis as a protein production host

    • Similar to how HtrA modifications enhance recombinant enzyme production

    • Could be targeted to improve production of nitrogen-rich products

  • Biomarker development:

    • YttA expression patterns could serve as a biomarker for nitrogen status in B. subtilis

    • Potential applications in monitoring industrial fermentation processes

  • Synthetic biology tools:

    • The promoter region containing TnrA-binding sites could be used to develop nitrogen-responsive genetic circuits

    • Engineering YttA for altered function might enable novel cellular responses to nitrogen availability

Understanding the precise function of YttA in the context of TnrA regulation presents an opportunity to develop new strategies for modulating bacterial responses to changing nitrogen availability, with potential applications in industrial biotechnology where B. subtilis serves as a key production host .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.