Recombinant Bacillus subtilis Uncharacterized membrane protein yuiB (yuiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Uncharacterized Membrane Protein yuiB (yuiB)

Recombinant Bacillus subtilis uncharacterized membrane protein yuiB (yuiB) is a bioengineered version of a putative membrane protein encoded by the yuiB gene (BSU32080) in Bacillus subtilis subsp. subtilis str. 168. Despite its classification as an "uncharacterized" protein, yuiB has garnered attention due to its structural features and potential roles in bacterial membrane processes.

Research Context and Functional Insights

While yuiB’s biological role remains undefined, its structural and genetic context provides clues about potential functions:

Membrane Protein Biogenesis

yuiB is predicted to reside in the bacterial membrane, sharing functional homology with proteins involved in membrane protein insertion and folding. For example:

  • YidC Homologs: B. subtilis encodes SpoIIIJ (YidC1) and YqjG (YidC2), which assist in membrane protein biogenesis. These proteins mediate the insertion of transmembrane domains, suggesting yuiB might interact with similar pathways .

  • Iron-Sulfur Clusters: While not directly linked to yuiB, B. subtilis Ric proteins (e.g., RicA, RicF, RicT) utilize Fe-S clusters to regulate RNA processing and developmental processes. This highlights the importance of metal-binding motifs in membrane proteins .

Related Proteins and Pathways

yuiB is part of a poorly characterized gene cluster. Comparative genomics reveals:

ProteinFunctionRelevance to yuiB
YueBPhage receptor for SPP1 adsorption Membrane receptor homolog
YidC/Oxa1Membrane protein insertion Structural/functional analogy
RicAFT ComplexRNA maturation, sporulation, biofilm formation Regulatory pathway interconnection

Applications in Research and Biotechnology

Recombinant yuiB is primarily used in structural studies and as a model for membrane protein engineering.

Host Strain Optimization

B. subtilis is increasingly used for recombinant protein production due to:

  • Fast Growth Rates: Doubling time as low as 20 minutes .

  • Sporulation Deficiency: Strains like 3NA and PY79S show higher protein yield (~37% dry cell weight) compared to sporulating strains .

Challenges and Future Directions

The lack of functional studies on yuiB limits its utility. Key research gaps include:

  1. Functional Annotation: Biochemical assays to identify binding partners or enzymatic activity.

  2. Phylogenetic Analysis: Comparative studies with homologs in other firmicutes (e.g., Streptococcus, Lactococcus).

  3. Membrane Localization: Confocal microscopy or immunogold labeling to confirm subcellular localization.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
yuiB; BSU32080; Uncharacterized membrane protein YuiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yuiB
Target Protein Sequence
MISLPVVIISIVLFFVLFFGIGFLLNMLLRMSWIMAVIYPIVCLFIISKEKLISYVQSPG ESFASLFHRVLSLAAADVLILVSGLAGAIVSGIAINMLRKRGYQMF
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should recombinant yuiB protein be stored and handled in laboratory settings?

For optimal stability, recombinant yuiB protein should be stored at -20°C to -80°C upon receipt. The lyophilized form provides greater stability for long-term storage. Important handling guidelines include:

  • Brief centrifugation of the vial before opening

  • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

  • Addition of glycerol (5-50% final concentration) for aliquoting and long-term storage

  • Avoidance of repeated freeze-thaw cycles

  • For working aliquots, storage at 4°C for up to one week is recommended

What reconstitution methods are recommended for lyophilized yuiB protein?

Recommended Reconstitution Protocol:

  • Centrifuge the vial briefly to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Create multiple aliquots to avoid repeated freeze-thaw cycles

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage

The reconstituted protein is typically in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What experimental approaches are suitable for characterizing the membrane localization of yuiB protein?

When investigating membrane localization of yuiB, researchers should consider multiple complementary approaches:

  • Fluorescence microscopy with tagged constructs:

    • Express yuiB fused to fluorescent proteins (such as YFP) to visualize subcellular localization

    • Use the Statistical Coefficient Index (SCI) to quantify nanodomain organization

    • Apply environmental-sensitive probes like di-4-ANEPPDHQ to assess membrane order in yuiB-enriched regions

  • Biochemical fractionation:

    • Isolate detergent-resistant membrane (DRM) fractions to determine if yuiB co-purifies with specific lipids

    • Apply density gradient centrifugation to separate membrane components

    • Perform Western blotting on fractions to detect yuiB distribution

  • Lipid manipulation assays:

    • Use compounds like fenpropimorph (fen) to alter membrane sterol composition

    • Apply enzymes such as phosphatidylinositol 4-phosphatase to modify phosphoinositide content

    • Monitor effects on yuiB localization and nanodomain organization following lipid modifications

How can researchers investigate potential protein-lipid interactions of yuiB?

Investigation of yuiB protein-lipid interactions requires a multi-faceted approach:

  • In vivo membrane manipulation experiments:

    • Express yuiB in cells with altered lipid compositions

    • Employ specific inhibitors of lipid biosynthesis to assess effects on yuiB localization

    • Use phosphoinositide-modifying enzymes (such as SAC1p) to alter PI4P levels and monitor yuiB distribution

  • In vitro binding assays:

    • Perform lipid overlay assays with purified yuiB protein

    • Use liposome flotation assays with varying lipid compositions

    • Apply surface plasmon resonance (SPR) to measure binding kinetics to specific lipids

  • Mutagenesis studies:

    • Create point mutations of key charged residues (e.g., lysines, arginines)

    • Generate single to multiple substitution mutants to identify critical residues

    • Analyze subcellular localization changes resulting from mutations, particularly focusing on triple to sextuple mutants that may significantly impair membrane targeting

What methods can be used to study the dynamics and mobility of yuiB within the membrane?

Membrane protein dynamics can be assessed using several cutting-edge techniques:

  • Fluorescence recovery after photobleaching (FRAP):

    • Measure the diffusion coefficient to quantify protein mobility

    • Compare wild-type yuiB with mutant variants to correlate mobility with function

    • Analyze recovery curves to determine mobile fraction percentages

  • Single-particle tracking:

    • Use photoconvertible fluorescent tags (e.g., EOS) to track individual molecules

    • Calculate mean square displacement to determine diffusion properties

    • Identify potential confinement zones indicating nanodomain partitioning

  • Super-resolution microscopy:

    • Apply techniques like PALM or STORM to visualize nanoscale organization

    • Quantify cluster size, density, and distribution

    • Correlate molecular mobility with nanodomain partitioning

Research indicates that membrane protein functionality may not directly correlate with immobility but rather with the ability to organize into supramolecular domains, suggesting that proper analysis of both dynamics and organization is crucial .

How should researchers address contradictions in experimental data related to yuiB protein function?

When confronting contradictory experimental results regarding yuiB function:

  • Apply a structured contradiction analysis framework:

    • Define the parameters of contradiction: number of interdependent items (α), number of contradictory dependencies (β), and minimal number of required Boolean rules (θ)

    • Classify contradictions to identify patterns that may reveal underlying issues

  • Systematically evaluate experimental variables:

    • Assess variations in expression systems (E. coli vs. Bacillus)

    • Compare protein tag effects (His-tag position, tag size, tag type)

    • Evaluate differences in membrane composition between experimental systems

  • Implement a data quality assessment strategy:

    • Verify technical reproducibility across independent experiments

    • Establish clear criteria for data validation and rejection

    • Use Boolean minimization methods to assess complex interdependencies in datasets

Contradiction ParameterDescriptionAssessment Approach
α (alpha)Number of interdependent data itemsMap all potentially related experimental variables
β (beta)Number of contradictory dependenciesDocument all observed inconsistencies across experiments
θ (theta)Minimal number of Boolean rules requiredApply logical minimization to simplify contradiction patterns

What experimental design strategies are recommended for elucidating yuiB protein function?

A robust experimental design for studying yuiB function should include:

  • Comparative analysis across different Bacillus species:

    • Identify orthologous proteins with known functions

    • Perform phylogenetic analysis to identify conserved domains

    • Use complementation assays to test functional conservation

  • Systematic gene knockout and phenotypic assessment:

    • Generate clean deletion mutants of yuiB in Bacillus subtilis

    • Assess growth under various environmental conditions (temperature, osmotic stress, pH)

    • Measure membrane integrity and permeability in wildtype vs. mutant strains

  • Structure-function relationship studies:

    • Create chimeric proteins with domains from characterized membrane proteins

    • Perform alanine scanning mutagenesis of predicted functional motifs

    • Correlate structural features with functional outcomes using a systematic design matrix

  • Interactome analysis:

    • Perform co-immunoprecipitation followed by mass spectrometry

    • Use bacterial two-hybrid systems to identify protein partners

    • Apply proximity labeling methods (BioID) to identify neighboring proteins in the membrane

What bioinformatic approaches can help predict yuiB protein function?

Comprehensive bioinformatic analysis should include:

  • Sequence-based predictions:

    • BLAST searches against characterized proteins

    • Multiple sequence alignment to identify conserved residues

    • Profile-based methods like PSI-BLAST and HHpred to detect remote homologs

  • Structural prediction and analysis:

    • Transmembrane topology prediction (TMHMM, Phobius)

    • Ab initio structure prediction (AlphaFold2, RoseTTAFold)

    • Molecular dynamics simulations to identify stable conformations and potential binding sites

  • Genomic context analysis:

    • Examine operonic organization in Bacillus genomes

    • Identify co-regulated genes through transcriptomic data mining

    • Apply gene neighborhood and gene fusion methods to predict functional associations

How can researchers optimize recombinant yuiB expression for structural studies?

For structural biology applications, optimize expression with these methodologies:

  • Expression system optimization:

    • Test multiple E. coli strains specialized for membrane protein expression (C41, C43, BL21)

    • Evaluate impact of different fusion tags (His, GST, MBP) on expression level and solubility

    • Optimize induction parameters (temperature, IPTG concentration, induction time)

  • Membrane extraction and protein purification:

    • Compare detergents for membrane solubilization (DDM, LMNG, GDN)

    • Implement a two-step purification strategy with affinity chromatography followed by size exclusion

    • Verify protein monodispersity using dynamic light scattering

  • Quality control assessments:

    • SDS-PAGE to confirm >90% purity

    • Mass spectrometry to verify protein integrity

    • Circular dichroism to assess secondary structure formation

DetergentAdvantagesLimitationsRecommended Starting Concentration
DDMWidely used, mildLarge micelle size1% for extraction, 0.03% for purification
LMNGSmall micelle, stabilizingExpensive, challenging to remove1% for extraction, 0.01% for purification
GDNExcellent for structural studiesVery expensive1% for extraction, 0.02% for purification

What controls should be implemented when studying recombinant yuiB in heterologous systems?

Rigorous control experiments must include:

  • Expression system controls:

    • Empty vector expression to assess background

    • Expression of a well-characterized membrane protein (positive control)

    • Expression of non-membrane protein with same tag (tag-specific control)

  • Functional assay controls:

    • Inclusion of non-functional mutants (e.g., mutated key residues)

    • Domain-swapped chimeras to delineate functional regions

    • Dose-response curves to establish specificity of observed effects

  • Localization study controls:

    • Co-localization with established membrane markers

    • Treatment with membrane-disrupting agents as negative controls

    • Comparison of different tag positions (N-terminal vs. C-terminal) to assess tag interference

How can molecular dynamics simulations enhance understanding of yuiB membrane interactions?

Molecular dynamics (MD) simulations offer powerful insights:

  • Simulation system setup:

    • Incorporate yuiB protein model into lipid bilayers of varying compositions

    • Include phospholipids, sterols, and phosphoinositides based on experimental data

    • Allow equilibration before production runs

  • Analysis of key parameters:

    • Monitor protein-lipid contacts throughout simulation

    • Calculate electrostatic interactions between charged residues and lipid headgroups

    • Assess hydrogen bonding networks and their stability

  • Advanced simulation approaches:

    • Implement coarse-grained simulations to observe larger-scale phenomena

    • Apply enhanced sampling techniques to explore conformational space

    • Use steered MD to investigate membrane insertion processes

Such simulations can identify specific residues involved in membrane interactions, similar to how REM-CA interactions with sterols and phosphoinositides were characterized through MD studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.