Recombinant Bacillus subtilis Uncharacterized membrane protein yuiD (yuiD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped standard with blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yuiD; BSU32060; Uncharacterized membrane protein YuiD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yuiD
Target Protein Sequence
MELLTNFPLLSSLAAIIFAQVIKVPIQFIVSRKLDWSLVTSTGGMPSSHSAAVTALSTGV ALEHGLDSSLFAVSAIFAVITMFDATGVRRHAGEQATVINKLVIDFNRFVNEAKDFPKAA EKEKQKKLKELLGHQPIEVFFGGLTGILLTLVLAYFFM
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What experimental approaches are recommended for initial characterization of the uncharacterized membrane protein YuiD?

Characterization of YuiD should begin with a multi-faceted approach that includes bioinformatic analysis to predict membrane topology and potential functional domains. Generate knockout strains to observe phenotypic changes and conduct localization studies using fluorescent protein fusions or immunolocalization. Consider performing comparative analysis with known membrane proteins in B. subtilis, such as SpoIIIJ and YqjG, which function in membrane protein biogenesis . Transcriptional analysis can help determine expression conditions, while preliminary functional assays should be designed based on predicted protein families and domains.

Which expression systems are most suitable for recombinant production of YuiD?

Homologous expression in B. subtilis offers significant advantages for membrane protein production. Research indicates that B. subtilis possesses outstanding capabilities for protein secretion, making it an excellent host for recombinant protein production . For optimal results, utilize genome-minimized strains lacking extracellular proteases, prophages, and genes for spore development, as these modifications have demonstrated dramatic improvements in protein production . When designing your expression system, carefully select optimal factors for gene expression, protein secretion, and protein folding to enhance yield and functionality .

How can growth conditions be optimized for maximum YuiD expression in B. subtilis?

Growth optimization is critical for successful membrane protein production. Evidence from membrane protein production studies shows that the most rapid growth conditions are not necessarily optimal for protein expression . It is crucial to grow cells under tightly-controlled conditions and harvest them prior to glucose exhaustion, just before the diauxic shift . Develop a systematic approach to quantify cultures in high-performance bioreactors under defined growth regimes, as this allows for reproducible and optimized protein yields . Additionally, tuning the production level to minimize stress responses may increase functional protein yield.

What techniques can reveal the membrane topology of YuiD?

Determining membrane topology requires both computational and experimental approaches. Begin with algorithm-based prediction tools to identify potential transmembrane domains. Experimentally validate these predictions using reporter fusion techniques with proteins like alkaline phosphatase (PhoA) or green fluorescent protein at different positions along the YuiD sequence. Accessibility studies using site-directed antibodies can further confirm extracellular versus cytoplasmic domains. For more detailed analysis, consider cysteine scanning mutagenesis combined with thiol-reactive labeling to determine which residues are accessible to the aqueous environment.

How might YuiD interact with membrane protein biogenesis factors in B. subtilis?

B. subtilis contains two Oxa1p homologs, SpoIIIJ and YqjG, which function in membrane protein biogenesis . To investigate potential interactions between YuiD and these systems, co-immunoprecipitation experiments can identify physical associations. Additionally, genetic approaches such as creating double mutants of yuiD with spoIIIJ or yqjG may reveal functional relationships. Research has shown that SpoIIIJ and YqjG facilitate membrane insertion of proteins into bacterial membranes and complement YidC function in E. coli . These proteins have been found associated with the entire F₁Fo ATP synthase complex, suggesting roles in late-stage assembly processes of membrane complexes .

What role might the Sec pathway play in YuiD membrane integration?

Investigating whether YuiD insertion is Sec-dependent or Sec-independent is crucial. Based on studies of other B. subtilis membrane proteins, both SecYEG-dependent and independent pathways exist for membrane protein insertion . Design experiments that deplete SecA or other Sec components to observe effects on YuiD membrane integration. In vitro translation-translocation assays using purified inner membrane vesicles can directly test SecYEG requirement. Site-specific crosslinking may capture transient interactions during membrane insertion, revealing the molecular pathway of YuiD integration.

What purification strategies are most effective for membrane proteins like YuiD?

Purification of membrane proteins requires specialized approaches. Begin with systematic detergent screening to identify optimal solubilization conditions. Implement affinity chromatography using tags (His, Strep, FLAG) for initial purification, followed by size exclusion chromatography for further purification and assessment of protein homogeneity. Consider native-like environments such as nanodiscs or liposomes for functional reconstitution. Importantly, assess protein stability under different buffer conditions, pH values, and ionic strengths to maintain structural integrity throughout the purification process.

Table 1: Recommended Detergents for B. subtilis Membrane Protein Purification

Detergent ClassExamplesCritical Micelle Concentration (mM)AdvantagesLimitations
MaltosideDDM, UDM0.17, 0.59Mild, maintains functionalityLarge micelles
GlucosideOG, NG25, 6.5Small micelles, crystallization-friendlyPotentially destabilizing
Fos-cholineFC-12, FC-141.5, 0.12High solubilization efficiencyMay denature protein
Neopentyl glycolLMNG, DMNG0.01, 0.036Enhanced stabilityExpensive
Steroid-basedDigitonin, CHAPS0.5, 8Very mild, native-like environmentBatch variability

What structural approaches are most suitable for an uncharacterized membrane protein like YuiD?

Structural characterization of YuiD should employ multiple complementary techniques. Circular dichroism spectroscopy can provide initial insights into secondary structure content. For high-resolution structures, consider X-ray crystallography using techniques like lipidic cubic phase crystallization, though this typically requires milligram quantities of purified protein. Single-particle cryo-electron microscopy offers advantages for membrane proteins that resist crystallization. For dynamic studies, hydrogen-deuterium exchange mass spectrometry can reveal conformational flexibility. Begin with homology modeling based on related proteins to guide experimental design, particularly if YuiD shares structural features with characterized membrane proteins.

How can advanced biophysical techniques determine YuiD oligomeric state and dynamics?

Determining if YuiD forms oligomeric complexes requires specialized approaches. Analytical ultracentrifugation of detergent-solubilized YuiD can determine molecular weight and oligomeric state. Blue native PAGE analysis can reveal native complex integrity while maintaining protein-protein interactions. FRET analysis using differentially labeled YuiD molecules can detect oligomerization in membranes. For in-depth dynamics, solid-state NMR can provide atomic-level information about protein motion within the membrane environment, while single-molecule tracking in live cells might reveal clustering behavior and diffusion properties.

What strategies can elucidate the function of uncharacterized membrane protein YuiD?

Functional characterization requires a multi-pronged approach. Comprehensive phenotypic analysis of knockout strains under diverse growth conditions can reveal condition-specific functions. Transcriptomic, proteomic, and metabolomic analyses can identify affected pathways when YuiD is absent or overexpressed. Protein interaction studies using techniques like affinity purification coupled with mass spectrometry may identify binding partners that suggest function. Given that certain B. subtilis membrane proteins like YisP are involved in biofilm formation , investigate whether YuiD impacts similar cellular processes. Evolutionary analysis identifying conserved residues and potential orthologs with known functions can provide additional functional insights.

How can researchers investigate potential roles of YuiD in biofilm formation or stress response?

Given that other B. subtilis membrane proteins like YisP play crucial roles in biofilm formation , YuiD might have similar functions. Design experiments comparing biofilm formation capabilities between wild-type and yuiD knockout strains. Assess if YuiD affects the production of extracellular matrix components or cell-cell communication. Test stress tolerance (pH, temperature, osmotic, oxidative) of yuiD mutants compared to wild-type strains. Quantitative RT-PCR can determine if yuiD expression changes under stress conditions or during different growth phases. Complementation experiments with related proteins from other species may provide additional functional insights.

Table 2: Recommended Assays for Functional Characterization of YuiD

Functional CategoryAssay TypeMeasured ParameterAdvantagesTechnical Complexity
Membrane IntegrityFluorescent Dye LeakageMembrane permeabilityQuantitative, real-timeMedium
Transport ActivitySubstrate UptakeTransport kineticsDirect functional assessmentHigh
Proton Motive ForceACMA FluorescenceΔpH generationEstablished techniqueMedium
Stress ResponseGrowth under StressSurvival/growth ratesPhysiologically relevantLow
Biofilm FormationCrystal Violet StainingBiofilm biomassQuantitativeLow
Protein-Protein InteractionCo-immunoprecipitationBinding partnersIdentifies complexesMedium-high
Lipid InteractionLipid Binding AssaysLipid specificityReveals membrane domain preferenceHigh

How can researchers address contradictory findings in YuiD characterization?

When encountering contradictory data about YuiD function, implement a systematic approach to resolve discrepancies. Carefully standardize experimental conditions across systems, including strain backgrounds, expression levels, and growth conditions. Use multiple complementary techniques to validate findings, as reliance on a single methodology may introduce technique-specific artifacts. Consider strain backgrounds and potential compensatory mechanisms that might mask phenotypes. Perform targeted mutagenesis of predicted functional residues to identify critical domains that explain functional discrepancies. Quantitative approaches comparing wild-type and mutant phenotypes under identical conditions can help resolve contradictions.

How can genome engineering approaches improve YuiD expression and characterization?

Leveraging genome minimization strategies can dramatically improve recombinant protein production. Research has demonstrated that genome-minimized B. subtilis strains can achieve over 3000-fold increased secretion of active proteins compared to parental reference strains . These optimized strains lack extracellular proteases, prophages, and genes for spore development, which are considered counterproductive traits for protein production . When designing your expression system, carefully select optimal factors for gene expression, protein secretion, and protein folding to enhance yield and functionality of difficult-to-express membrane proteins like YuiD .

What approaches can identify potential substrates or interaction partners of YuiD?

Identifying interaction partners can provide crucial insights into YuiD function. Implement affinity purification coupled with mass spectrometry using tagged YuiD as bait. Bacterial two-hybrid screening can detect direct protein-protein interactions. Differential proteomics comparing wild-type and yuiD knockout strains may reveal proteins whose abundance or modification state depends on YuiD. Research on other B. subtilis membrane proteins has shown they can form specific associations with large complexes, such as the ATP synthase , suggesting YuiD might similarly participate in multi-protein assemblies. Crosslinking experiments combined with mass spectrometry can capture transient interactions in their native membrane environment.

How might post-translational modifications affect YuiD function?

Post-translational modifications can significantly impact membrane protein function. Mass spectrometry analysis of purified YuiD can identify potential modifications such as phosphorylation, glycosylation, or lipidation. Site-directed mutagenesis of predicted modification sites can determine their functional significance. Compare YuiD modifications from cells grown under different conditions to identify environment-responsive modifications. Identify enzymes responsible for these modifications through co-immunoprecipitation or genetic screens. Functional assays comparing wild-type and modification-deficient YuiD variants can reveal the physiological importance of these modifications in different cellular contexts.

How can single-cell approaches advance our understanding of YuiD function?

Single-cell technologies offer unprecedented insights into protein function. Single-molecule tracking can reveal YuiD dynamics, diffusion properties, and potential clustering in the membrane. Time-lapse fluorescence microscopy using YuiD-fluorescent protein fusions can monitor protein localization throughout the cell cycle and under various stress conditions. Single-cell RNA-seq comparing wild-type and yuiD mutant cells may uncover cell-to-cell variability in transcriptional responses. These approaches can detect heterogeneity in YuiD expression or function that might be masked in population-level studies, potentially revealing specialized roles in subpopulations of cells.

What computational approaches can predict YuiD function and guide experimental design?

Computational methods can accelerate functional characterization. Begin with advanced homology modeling and molecular dynamics simulations to predict structure and conformational dynamics. Machine learning algorithms trained on characterized membrane proteins can suggest potential functions based on sequence and predicted structural features. Network analysis integrating transcriptomic, proteomic, and metabolomic data can place YuiD in specific cellular pathways. Molecular docking simulations can predict potential substrates or binding partners. These computational predictions should generate testable hypotheses to guide experimental design, creating an iterative process of prediction and validation.

How might YuiD research contribute to broader understanding of bacterial membrane biology?

Research on uncharacterized membrane proteins like YuiD contributes to fundamental understanding of bacterial physiology. Findings may reveal novel mechanisms of membrane protein biogenesis, potentially expanding our knowledge beyond established systems like SpoIIIJ and YqjG . Characterization may uncover previously unknown signaling or transport processes that control bacterial responses to environmental conditions. Given the connection between membrane proteins and biofilm formation in B. subtilis , YuiD research might provide insights into bacterial community behavior and development. Additionally, this research contributes to the broader goal of comprehensive understanding of membrane proteomes, addressing one of the major challenges in contemporary structural genomics programs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.