Recombinant Bacillus subtilis Uncharacterized membrane protein yvaE (yvaE)

Shipped with Ice Packs
In Stock

Description

Overview of Bacillus subtilis Membrane Protein Research

B. subtilis is a model organism for studying membrane protein biogenesis due to its well-characterized secretion pathways and genetic tractability. Key findings from the search results include:

  • YidC Family Proteins: Two homologs, SpoIIIJ/YidC1 and YqjG/YidC2, mediate membrane protein insertion and folding. YidC2 is upregulated via a ribosome–nascent chain sensor (MifM) when YidC1 activity is compromised .

  • Sec System Components: The SecYEG translocon and SecA ATPase facilitate protein secretion, while YvaL (a SecG homolog) plays a role in maintaining translocon efficiency. Disruption of yvaL causes cold sensitivity and secretion defects .

  • Recombinant Protein Production: B. subtilis is widely used for secretory protein production, leveraging promoters like Pgrac, inducible systems (e.g., IPTG), and strain engineering to mitigate proteolytic degradation .

Challenges in Characterizing Uncharacterized Membrane Proteins

Uncharacterized membrane proteins like YvaE often lack functional annotations due to:

  • Genetic Redundancy: B. subtilis encodes multiple paralogs (e.g., YidC1/YidC2) that complicate functional studies .

  • Expression Bottlenecks: Overproduction of membrane proteins can trigger stress responses (e.g., CssRS and σᴹ regulons), limiting yields without targeted strain optimization .

  • Structural Complexity: Membrane proteins require specialized purification strategies, such as His-tag affinity chromatography with lipid-based solubilization .

Methodological Framework for Studying YvaE

If YvaE were to be investigated, the following approaches (derived from current B. subtilis research) would apply:

Table 1: Recombinant Protein Production Workflow

StepProtocolKey Considerations
CloningUse vectors like pHT254 with inducible promoters (e.g., Pgrac) Codon optimization for B. subtilis; inclusion of signal peptides for secretion.
TransformationNatural competence or electroporation Selection markers (e.g., chloramphenicol resistance) and strain compatibility (e.g., WB800N for reduced proteolysis) .
ExpressionIPTG induction or self-inducing systems Monitor cell envelope stress responses (e.g., CssRS activation) .
PurificationHis Mag Sepharose Ni beads for IMAC Solubilization with detergents (e.g., DDM); stability assays in lipid bilayers.

Related Findings on B. subtilis Membrane Proteins

  • YvaL (SecG Homolog): Integral to the Sec translocon; deletion causes β-lactamase secretion defects and cold sensitivity. Complementation with E. coli SecG restores function .

  • MifM-YidC2 Regulatory Axis: Translational arrest of MifM nascent chains regulates YidC2 expression, ensuring membrane protein biogenesis homeostasis .

  • Industrial Applications: Recombinant B. subtilis strains are engineered for high-yield production of enzymes, vaccines, and antibodies, leveraging secretion pathways and stress-response evasion .

Implications for YvaE Research

While YvaE remains uncharacterized, insights from analogous proteins suggest:

  • Functional Predictions: If YvaE is a Sec/YidC-associated protein, it may participate in translocation or membrane insertion.

  • Experimental Priorities:

    1. Gene Knockout: Assess growth defects or secretion impairments.

    2. Interaction Studies: Use pull-down assays to identify binding partners (e.g., SecYEG components).

    3. Structural Analysis: Cryo-EM or X-ray crystallography after overexpression in optimized strains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request as much as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which serves as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
yvaE; BSU33570; Uncharacterized membrane protein YvaE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yvaE
Target Protein Sequence
MNWVFLCLAILFEVAGTVSMKLSSGFTKLIPSLLLIFFYGGSLFFLTLTLKSIDVSVAYA VWSGMGIVLITVVGFLFFQEHVSVMKVISIGLIIAGVVSLNLIEHVAVSEPVHKSGQYK
Uniprot No.

Target Background

Database Links
Protein Families
Small multidrug resistance (SMR) protein family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the current state of knowledge about uncharacterized membrane proteins in Bacillus subtilis?

Uncharacterized membrane proteins in B. subtilis represent an important research frontier. While the complete genome of B. subtilis has been sequenced, many membrane proteins remain functionally uncharacterized, including yvaE. Current research approaches focus on systematic characterization through genomic analysis, homology studies, and functional assays. Based on similar studies with other membrane proteins like yvbJ, researchers are working to identify protein functions through comparative genomics and experimental validation .

The study of membrane proteins requires specialized techniques due to their hydrophobic nature and structural complexity. Research on uncharacterized proteins typically begins with bioinformatic analysis to identify conserved domains, followed by expression studies and functional assays. Membrane proteome studies in bacteria have established methodologies for protein isolation and characterization that can be applied to proteins like yvaE .

What expression systems are most effective for recombinant Bacillus subtilis membrane proteins?

For recombinant expression of B. subtilis membrane proteins, several expression systems have proven effective, with the choice depending on research objectives:

  • Homologous expression in B. subtilis: Often preferred for maintaining native protein folding and post-translational modifications. This approach uses chassis strains engineered for improved protein expression, similar to those developed through lifespan engineering strategies .

  • Heterologous expression in E. coli: Commonly used due to ease of genetic manipulation and high yield, but may require optimization for proper membrane protein folding.

  • Cell-free expression systems: Useful for difficult-to-express or toxic membrane proteins.

Methodologically, effective expression requires careful consideration of promoter strength, induction conditions, and strain selection. For instance, engineered B. subtilis chassis cells developed through chronological lifespan engineering can provide improved biomass yields (10-20% increases) and reduced autolysis, potentially improving membrane protein expression .

How can researchers effectively isolate and purify recombinant membrane proteins from Bacillus subtilis?

Isolation and purification of recombinant membrane proteins from B. subtilis requires a systematic approach:

  • Cell lysis: Sonication methods (4 pulses on ice at 15 sec each, with 45 sec rest between pulses) in appropriate buffer systems (containing protease inhibitors) effectively disrupt B. subtilis cells while preserving membrane integrity .

  • Membrane fraction isolation: Ultracentrifugation at 40,000 × g for 30 minutes separates total membrane fractions that contain both inner and outer membrane proteins .

  • Solubilization: Membrane proteins require detergents for solubilization. Zwitterionic detergents like Zwittergent 3-14 (2%) have proven effective for solubilizing bacterial membrane proteins .

  • Purification techniques:

    • Affinity chromatography (if tagged)

    • Ion exchange chromatography

    • Size exclusion chromatography

For biotin-tagged proteins, monomeric avidin magnetic beads can be used for selective purification, with proteins eluted using D-Biotin (5 mM) . Precipitating purified proteins with TCA (20%) or cold acetone can concentrate samples for further analysis.

What are optimal conditions for expressing uncharacterized membrane proteins in Bacillus subtilis?

Optimizing expression conditions for uncharacterized membrane proteins in B. subtilis requires careful experimental design:

ParameterRecommended RangeConsiderations
Growth Temperature25-37°CLower temperatures (25-30°C) often improve proper folding
Media CompositionLB, 2xYT, Minimal mediaMedia selection impacts growth rate and protein expression
Induction PointMid-log phase (OD600 0.6-0.8)Earlier induction may reduce toxicity but lower yield
Induction Duration4-24 hoursMembrane proteins often benefit from longer expression periods
Salt Concentration0.5-1.5% NaClSalt concentration affects membrane composition

For improved expression, consider engineered B. subtilis chassis strains with modifications to autolysis-related genes like lytC, sigD, pcfA, and flgD, which have demonstrated 11-20% increases in biomass yields . These strains may provide more stable expression platforms for membrane proteins by reducing cellular autolysis.

When expressing toxic or structurally complex membrane proteins, systematic optimization through factorial design experiments is recommended to identify optimal conditions for specific protein targets.

What techniques are most effective for functional characterization of uncharacterized membrane proteins?

Functional characterization of uncharacterized membrane proteins like yvaE requires a multi-faceted approach:

  • Transcriptional analysis: Mapping promoter regions using primer extension and Northern blotting to identify expression patterns, as demonstrated with yvyD gene regulation by σB and σH transcription factors .

  • Protein localization: Fluorescent protein fusions or immunolabeling to confirm membrane localization and distribution.

  • Interaction studies:

    • Pull-down assays

    • Bacterial two-hybrid systems

    • Crosslinking experiments

    • Co-immunoprecipitation

  • Phenotypic analysis: Creation of gene knockouts or conditional mutants to observe phenotypic changes, as done with autolysis genes in B. subtilis (resulting in 10-20% changes in biomass) .

  • Comparative genomics: Identifying homologous proteins with known functions can provide clues to function, as demonstrated with yvyD's homology to σ54 modulation factors .

Researchers should consider both forward and reverse genetic approaches, combining phenotypic observations with molecular characterization to build a comprehensive understanding of protein function.

How can researchers effectively analyze membrane protein topology and structure in Bacillus subtilis?

Analyzing membrane protein topology and structure requires specialized methodologies:

  • Computational prediction: Use of topology prediction algorithms (TMHMM, TOPCONS) provides initial insights into transmembrane domains and orientation.

  • Experimental topology mapping:

    • Reporter fusion analysis (PhoA, LacZ, GFP)

    • Cysteine scanning mutagenesis with membrane-impermeable reagents

    • Protease accessibility assays

  • Structural analysis techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (increasingly important for membrane protein structures)

    • NMR spectroscopy (for smaller membrane proteins or domains)

    • Molecular dynamics simulations

  • Surface accessibility studies: Surface-exposed proteins can be labeled using amine-reactive reagents like Sulfo-NHS-LC-biotin for selective purification and identification .

For preparation of samples for structural studies, modifications to standard protocols are often necessary. Membrane proteins require careful detergent selection for solubilization while maintaining native structure. For mass spectrometry analysis, protocols using 8M urea in 250 mM TEAB (pH 8.0) for reconstitution, followed by reduction with TCEP, alkylation with MMTS, and digestion with trypsin have proven effective for membrane proteomes .

What approaches can resolve challenges in expressing and characterizing difficult membrane proteins?

Challenging membrane proteins often require specialized approaches:

  • Expression optimization strategies:

    • Use of fusion partners (MBP, SUMO) to enhance solubility

    • Codon optimization for B. subtilis

    • Inducible promoter systems with tight regulation

    • Co-expression with chaperones

  • Alternative host systems:

    • Cell-free expression systems

    • Specialized B. subtilis strains with enhanced membrane protein expression capabilities

    • Chassis cells engineered through lifespan engineering, which demonstrate improved biomass and reduced autolysis

  • Solubilization and stabilization:

    • Screening detergent panels (non-ionic, zwitterionic, and lipid-like detergents)

    • Nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs) for native-like lipid environments

    • Application of amphipols or fluorinated surfactants

  • Functional reconstitution:

    • Proteoliposome reconstitution for functional assays

    • Development of cell-based reporter systems

When facing expression difficulties, systematic troubleshooting using small-scale expression trials can identify optimal conditions before scaling up. The enhanced robustness of engineered B. subtilis chassis cells makes them particularly valuable for difficult-to-express membrane proteins .

How should researchers analyze and interpret proteomics data for uncharacterized membrane proteins?

Proteomics data analysis for uncharacterized membrane proteins requires specialized approaches:

  • Sample preparation considerations:

    • Enrichment of membrane fractions through ultracentrifugation at 40,000 × g for 30 min

    • Careful detergent selection for solubilization

    • Appropriate digestion protocols optimized for hydrophobic proteins

  • Quantitative proteomics approaches:

    • iTRAQ labeling enables comparative analysis across conditions (e.g., comparing protein expression under different salt concentrations)

    • Label-free quantification methods

    • SILAC for in vivo labeling

  • Data analysis workflow:

    • Database searching with consideration for membrane protein-specific parameters

    • False discovery rate control

    • Post-translational modification analysis

    • Protein network analysis

  • Functional interpretation:

    • Gene Ontology enrichment analysis

    • Pathway analysis

    • Protein-protein interaction networks

    • Comparison with known functional domains

What are the best approaches for designing knockout or mutation studies for functional analysis of membrane proteins?

Designing effective knockout or mutation studies for membrane proteins requires careful planning:

  • Knockout strategy selection:

    • Complete gene deletion versus insertion inactivation

    • Clean deletions using marker-free systems

    • Conditional knockouts for essential genes

    • CRISPR-Cas9 systems adapted for B. subtilis

  • Mutation design approaches:

    • Alanine scanning of transmembrane domains

    • Targeted mutations of predicted functional residues

    • Chimeric protein construction

    • Domain swapping with characterized homologs

  • Phenotypic analysis methods:

    • Growth assays under various conditions

    • Stress response evaluation

    • Membrane integrity tests

    • Specific functional assays based on predicted function

  • Complementation tests:

    • Expression of wild-type protein from ectopic locus

    • Complementation with homologs from related species

    • Point mutant complementation to confirm specific residue functions

When analyzing results, researchers should consider that membrane protein mutations may have pleiotropic effects due to potential disruption of membrane integrity or protein-protein interactions. Comprehensive phenotypic characterization, including tests for biofilm formation (which may be affected by membrane protein alterations) , provides a more complete understanding of protein function.

How can researchers investigate the role of uncharacterized membrane proteins in biofilm formation and resistance?

Investigating membrane proteins' roles in biofilm formation requires specialized approaches:

  • Biofilm formation assays:

    • Static microtiter plate assays

    • Flow cell systems

    • Confocal microscopy for three-dimensional structure analysis

  • Resistance testing protocols:

    • Challenge biofilms with antimicrobials like peracetic acid (3500 ppm)

    • Real-time visualization using non-invasive 4D confocal imaging

    • Quantification via standard plate counting methods

  • Matrix analysis:

    • Quantification of extracellular polymeric substances

    • Analysis of protein, polysaccharide, and DNA components

    • Correlation between matrix composition and resistance

  • Mixed species biofilm studies:

    • Co-culture systems (e.g., B. subtilis with S. aureus)

    • Analysis of interspecies protection mechanisms

    • Species-specific quantification methods

Biofilm studies should consider that B. subtilis strains can form biofilms with distinctive three-dimensional structures that contribute to antimicrobial resistance. The extracellular matrix can hinder penetration of antimicrobial agents , and membrane proteins may play crucial roles in matrix production, export, or biofilm architecture regulation.

What approaches can determine if an uncharacterized membrane protein is involved in stress response pathways?

Determining involvement in stress response pathways requires systematic investigation:

  • Transcriptional regulation analysis:

    • Mapping promoter regions using primer extension

    • Identifying transcription factor binding sites

    • Northern blot analysis under various stress conditions

    • Real-time PCR for expression quantification

  • Regulon mapping:

    • Global transcriptome analysis comparing wild-type and mutant strains

    • ChIP-seq for direct identification of transcription factor binding

    • Identification of regulatory networks (similar to σB and σH regulons)

  • Stress response assays:

    • Growth under various stressors (salt, temperature, pH, oxidative stress)

    • Survival rate determination

    • Specific physiological responses measurement

  • Protein modification and localization:

    • Phosphorylation state analysis

    • Membrane localization changes under stress

    • Protein-protein interaction changes

Studies with the yvyD gene demonstrated dual control by σB (stress response) and σH (nutrient limitation) transcription factors , illustrating how membrane proteins may integrate multiple regulatory inputs. Similar approaches can reveal if yvaE participates in stress response networks, potentially identifying new regulatory connections between stress response systems.

How can researchers overcome technical challenges in crystallizing membrane proteins from Bacillus subtilis?

Membrane protein crystallization presents unique challenges that require specialized approaches:

  • Protein preparation optimization:

    • Detergent screening (type, concentration)

    • Lipid addition for stabilization

    • Removal of flexible regions

    • Thermal stability screening

    • Surface engineering to promote crystal contacts

  • Crystallization strategies:

    • Lipidic cubic phase (LCP) methods

    • Bicelle crystallization

    • Vapor diffusion with specialized additives

    • Microseeding techniques

    • Antibody fragment co-crystallization

  • Alternative structural approaches:

    • Cryo-electron microscopy (increasingly powerful for membrane proteins)

    • Solid-state NMR for proteins in native-like environments

    • Small-angle X-ray scattering for low-resolution envelopes

  • Expression modifications:

    • Engineering thermostable variants

    • Creating fusion constructs with crystallization chaperones

    • Expression in specialized B. subtilis chassis cells with improved yields

Researchers should consider that membrane proteins often require hundreds of crystallization conditions to identify successful parameters. Systematic approaches, starting with stability optimization before crystallization trials, improve success rates. The robust B. subtilis chassis cells developed through lifespan engineering may provide better starting material for structural studies .

How should researchers approach comparative analysis between uncharacterized membrane proteins and known homologs?

Comparative analysis requires systematic methodology:

  • Sequence-based approaches:

    • PSI-BLAST for distant homolog identification

    • Multiple sequence alignment with membrane protein-specific parameters

    • Conservation analysis of transmembrane regions

    • Identification of functional motifs

  • Structural comparison methods:

    • Homology modeling using known structures as templates

    • Threading approaches for remote homologs

    • Evaluation of predicted structural features

    • Analysis of conserved structural elements

  • Functional comparison strategies:

    • Heterologous complementation tests

    • Domain swapping experiments

    • Targeted mutagenesis of conserved residues

    • Comparative biochemical assays

  • Evolutionary analysis:

    • Phylogenetic tree construction

    • Analysis of co-evolution patterns

    • Identification of lineage-specific adaptations

The yvyD gene product of B. subtilis demonstrates 30-40% identity with σ54 modulation factors in gram-negative bacteria , illustrating how comparative analysis can provide functional insights. When studying yvaE, similar approaches could reveal functional relationships with characterized proteins in other bacterial species, potentially identifying conserved membrane protein families with known functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.