Recombinant Bacillus subtilis Uncharacterized membrane protein yvbJ (yvbJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
yvbJ; BSU33880; Uncharacterized membrane protein YvbJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-605
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yvbJ
Target Protein Sequence
MLFCKNCGSQNNEGAKFCKQCGTPIGGGSKQANQETASTAETRQAPRKPIPKKTIILWSS IAAACVILFAAYKTGAYFTSKDRLVDKFEQAVNDGDQDQIATLLTPVNDNLKLTKNNVKP FLTYLKDHPDKKDELFASLRDETAQKDIVYAEKDGKSLLVFDHYDLKVAPVYFEVSSNYK NTDLYVNKEEAGSVKKADQAQTLGPYIPGEYTVSAKLKNDVVDLVKKEDIQAIGDSSFRV DLSLEADDVTFSLANDIKSGKGDLLINGKSIHKDPFKSVTYGPLLTDGSMTASVEAEFPW GKTKTAGVPIDDKEMELTLIPDQDTQEQIMNTIVKTTKQYSKALSDGNTAQMTEASANWK AETKDTVDSMKSADSYLKDRYLETDFDLDTFALSQKNDGTWQVSVTGKELHQSSSYNDYT KSEMTDDSPSYEYLLSYDKKQKKWIFEDAESTFESAGTNIKKIKNDKPETYTSAWAGSKN KGSESSASGDVTDEQVTLFMGSYLQSQADAVNQNNFSLMEDSLEKGSSLYSDQQHLVSKL NKEGTTEDFNNYEVKSWSQNGSAITIKTYEEFYITKSGGSPKLRTYNWTYTGVVKNGRIY LTSIQ
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What expression systems are most effective for recombinant YvbJ production?

    E. coli is the most commonly utilized expression host for recombinant YvbJ protein production . The methodology typically involves:

    • Cloning the yvbJ gene into a pET21a(+) or similar expression vector with appropriate tags (typically His-tag)

    • Transformation into an expression strain such as E. coli C41(DE3), which is optimized for membrane protein expression

    • Induction of protein expression using IPTG

    • Purification via affinity chromatography, commonly using nickel-nitrilotriacetic acid resin for His-tagged proteins

    Alternative expression systems including yeast, baculovirus, and mammalian cell systems are also viable options for producing recombinant YvbJ when solubility or post-translational modifications are concerns . Cell-free expression systems can be employed for challenging membrane proteins to avoid toxicity issues .

  • What are the challenges in purifying membrane proteins like YvbJ?

    Membrane proteins present several unique challenges during purification:

    1. Solubilization difficulties: Membrane proteins require detergents or alternative solubilization strategies to extract them from lipid bilayers

    2. Under-digestion during proteomic analysis: As demonstrated in studies of archaeal membrane proteins, proteins like YvbJ with hydrophobic domains often remain under-digested by trypsin . A complementary approach using chymotrypsin has proven effective for recovering these under-digested membrane proteins.

    3. Maintaining proper folding: The native conformation can be difficult to preserve during purification, affecting functional studies

    4. Protein yield limitations: Membrane proteins typically express at lower levels than soluble proteins

    For YvbJ specifically, researchers should consider using specialized detergents for extraction, optimizing buffer conditions, and employing orthogonal proteolytic enzymes for analysis .

  • How do you verify the quality of purified recombinant YvbJ?

    Quality assessment of purified recombinant YvbJ should include:

    1. Purity analysis: SDS-PAGE with Coomassie staining to confirm >80-90% purity . Commercial preparations typically achieve ≥85% purity.

    2. Identity confirmation: Western blotting using anti-His antibodies (for His-tagged proteins) at 1:4,000 dilution or mass spectrometry analysis.

    3. Homogeneity assessment: Size-exclusion chromatography to determine if the protein exists as a monomer or forms oligomers.

    4. Functional integrity: Since YvbJ's function is uncharacterized, structural integrity can be assessed via circular dichroism to confirm secondary structure.

    5. Endotoxin testing: For preparations intended for cellular studies, endotoxin levels should be <1.0 EU per μg of protein using the LAL method .

  • What storage conditions are recommended for recombinant YvbJ preparations?

    Based on available data from suppliers and literature, optimal storage conditions for recombinant YvbJ include:

    1. Short-term storage: 4°C for up to one week

    2. Long-term storage: -20°C to -80°C with protein aliquoted to avoid freeze-thaw cycles

    3. Buffer composition: Tris/PBS-based buffer with 6% trehalose at pH 8.0 or with 50% glycerol

    4. Reconstitution: For lyophilized preparations, reconstitution in deionized sterile water to 0.1-1.0 mg/mL is recommended

    5. Stabilization: Addition of protease inhibitors for preparations lacking preservatives

    Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and aggregation .

Advanced Research Questions

  • What approaches can be used to determine the function of uncharacterized membrane proteins like YvbJ?

    Several complementary approaches can be employed to elucidate YvbJ function:

    1. Genetic approaches:

      • Gene knockout studies: yvbJ mutants show increased conjugation of ICEBs1 (integrative and conjugative elements) , suggesting a potential role in horizontal gene transfer regulation

      • Conditional expression systems using IPTG-regulated alleles as demonstrated with TagV

      • Complementation studies with wild-type and mutant versions

    2. Protein interaction studies:

      • Bacterial Two-Hybrid (BACTH) system with adenylate cyclase fragments (T18 and T25) to identify interaction partners

      • Proximity-dependent biotin labeling (BioID) as demonstrated for YidC

      • Affinity purification-mass spectrometry from native membranes

    3. Localization and topology analysis:

      • Fluorescence microscopy with GFP fusion proteins

      • Membrane fractionation studies

      • Protease accessibility mapping

    4. Comparative genomics:

      • Analysis of conservation patterns across bacterial species

      • Identification of conserved domains or motifs

      • Examination of genomic context and operonic structure

  • How can researchers design experiments to identify potential biochemical activities of YvbJ?

    Given the lack of characterized function for YvbJ, a systematic approach to identifying biochemical activities includes:

    1. Sequence-based prediction:

      • Domain analysis to identify potential catalytic motifs

      • Structural homology modeling based on related proteins

    2. Biochemical activity screening:

      • Testing for common enzymatic activities (hydrolase, transferase, etc.)

      • Given that YvbJ is a membrane protein, testing for transport or channel activities

      • Examining potential roles in lipid metabolism or membrane organization based on the effects of YibN on membrane lipid production

    3. In vitro assays based on phenotypes:

      • Since yvbJ mutants show increased conjugation of ICEBs1 , examining DNA binding or processing activities

      • Testing for roles in competence similar to YvcJ, which positively controls late competence gene expression

    4. Substrate screening:

      • If YvbJ has enzymatic activity, substrate screening can be performed using libraries of potential substrates

      • For nucleotide-binding proteins like YvcJ, testing for nucleotide binding and hydrolysis activities

  • What is known about the genomic context and regulation of YvbJ expression in B. subtilis?

    The genomic context provides important clues to YvbJ function:

    1. Genomic location: The yvbJ gene is located at coordinates 3,474,106-3,475,923 in the B. subtilis genome

    2. Operon structure: yvbJ is expressed as a single gene in its own transcriptional unit

    3. Regulation: Limited information is available on direct regulators of yvbJ, but:

      • The terminator is inhibited by NusA (N-utilizing substance A) , suggesting regulation at the level of transcription termination

      • It has not been reported as part of major regulons in B. subtilis

    4. Expressional context:

      • Membrane proteome studies have detected YvbJ expression during normal growth conditions

      • The protein appears to be constitutively expressed but detailed expression profiles under different conditions have not been reported

  • How can structural studies be designed for a challenging membrane protein like YvbJ?

    Structural characterization of YvbJ would require:

    1. Crystallography approaches:

      • Optimization of detergent conditions for crystallization

      • Use of lipidic cubic phase (LCP) crystallization

      • Generation of antibody fragments to stabilize flexible regions

    2. Cryo-electron microscopy:

      • Reconstitution in nanodiscs or amphipols

      • Use of Fab fragments for size enhancement

      • Single-particle analysis or tomography depending on size

    3. NMR spectroscopy:

      • Expression with isotope labeling (13C, 15N)

      • Selection of detergent micelles suitable for NMR

      • Focus on specific domains if the full-length protein is challenging

    4. Alternative approaches:

      • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational dynamics

      • Cross-linking mass spectrometry to map intramolecular interactions

      • Computational modeling validated by experimental constraints

  • How does YvbJ compare to other characterized membrane proteins in B. subtilis?

    Comparative analysis with better-characterized B. subtilis membrane proteins reveals:

    ProteinFunctionMW (kDa)TMDsCharacterization LevelKey Properties
    YvbJUnknown67.10MultipleLow (uncharacterized)Increased ICEBs1 conjugation in mutants
    YvcIRNA pyrophosphohydrolase--MediumConverts RNA 5'-di/triphosphates to monophosphates
    YvcJNucleotide binding/hydrolysis--MediumAffects competence gene expression
    YidCMembrane protein insertase-MultipleHighEssential for membrane protein biogenesis
    TagVLCP enzyme--MediumImportant for cell wall synthesis and growth

    Unlike YidC, which has a well-defined role as an insertase for membrane proteins , or YvcI, which demonstrates RNA pyrophosphohydrolase activity , YvbJ's function remains largely unknown. The increased conjugation phenotype of yvbJ mutants may suggest a role in regulating horizontal gene transfer or membrane functions related to conjugation .

  • What experimental designs can elucidate potential interactions between YvbJ and the cell wall synthesis machinery?

    Given the importance of membrane proteins in cell wall synthesis, experiments to investigate YvbJ's potential involvement could include:

    1. Co-localization studies:

      • Fluorescent tagging of YvbJ and known cell wall synthesis proteins

      • Super-resolution microscopy to determine spatial relationships

      • Time-lapse imaging during cell growth and division

    2. Interaction screening:

      • Bacterial two-hybrid assays with known cell wall synthesis proteins

      • Co-immunoprecipitation followed by mass spectrometry

      • Crosslinking studies to capture transient interactions

    3. Phenotypic analysis:

      • Electron microscopy of cell wall architecture in yvbJ mutants

      • Testing sensitivity to cell wall-targeting antibiotics

      • Analysis of peptidoglycan composition and crosslinking

    4. Functional complementation:

      • Testing whether YvbJ can complement defects in related membrane proteins

      • Construction of chimeric proteins to identify functional domains

      • Protein domain swap experiments with LCP enzymes like TagV

  • How can transcriptomic and proteomic approaches be used to understand YvbJ function?

    Multi-omics approaches offer powerful insights into YvbJ function:

    1. Transcriptomics:

      • RNA-seq comparing wild-type and yvbJ deletion strains under various conditions

      • Analysis of gene expression changes during conditions where conjugation is active

      • Identification of co-regulated genes that might share functional relationships

    2. Proteomics:

      • Comparative membrane proteomics of wild-type and mutant strains

      • Application of multi-enzyme digestion strategies for better membrane protein coverage :

        • Primary digestion with trypsin

        • Reprocessing of under-digested material with chymotrypsin

        • Combined analysis for improved sequence coverage

      • Protein-protein interaction mapping through proximity labeling

    3. Metabolomics:

      • Analysis of membrane lipid composition in yvbJ mutants

      • Identification of metabolites that accumulate or decrease in the absence of YvbJ

    4. Integration of multi-omics data:

      • Pathway analysis to identify cellular processes affected by YvbJ

      • Network analysis to position YvbJ within the cellular interactome

      • Machine learning approaches to predict function from integrated datasets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.