Recombinant Bacillus subtilis Uncharacterized membrane protein yvdS (yvdS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yvdS; BSU34490; Uncharacterized membrane protein YvdS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yvdS
Target Protein Sequence
MNWVLVFIAGLLEVVWASSLKHADSLLDWIIIFILIAVSFILLIRSYQKIPMAAAYTVFV GIGTVGTYLTGIVLGESFSAAQMFFLALLLAGILGMKLFTKESKSQPGGEK
Uniprot No.

Target Background

Database Links
Protein Families
Small multidrug resistance (SMR) protein family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is yvdS and why is it classified as an uncharacterized membrane protein?

The yvdS protein is a membrane protein encoded by the yvdS gene in Bacillus subtilis. It remains classified as "uncharacterized" because its precise function, substrate specificity, and regulatory mechanisms have not been fully elucidated. While genomic analyses have identified its existence, detailed functional studies are still needed to determine its role within the bacterial cell membrane. Unlike well-characterized transport proteins such as YveA, which has been identified as an L-aspartate transporter in B. subtilis, yvdS awaits comparable functional annotation .

What expression systems are most effective for producing recombinant yvdS protein?

For recombinant yvdS production, several expression systems have demonstrated efficacy. The most productive approach typically involves using shuttle vectors similar to those employed for other B. subtilis membrane proteins. For instance, the E. coli-B. subtilis shuttle vector system (such as pMK4) has proven effective for membrane protein expression in these organisms . When expressing membrane proteins like yvdS, it's advisable to use inducible promoters such as Pspac, which allows for controlled expression levels to prevent toxicity from membrane protein overexpression. Expression optimization requires careful consideration of factors including induction timing, temperature modulation (typically lowered to 16-20°C during induction), and supplementation with specific membrane-stabilizing compounds.

What purification strategies yield the highest quality recombinant yvdS protein?

Purification of membrane proteins like yvdS requires specialized protocols distinct from those used for soluble proteins. The most effective strategy involves:

  • Initial membrane isolation via differential centrifugation following cell lysis

  • Membrane solubilization using appropriate detergents (typically mild non-ionic detergents like DDM or LMNG)

  • Affinity chromatography utilizing an engineered tag (His6 or Strep-tag)

  • Size exclusion chromatography to enhance purity and remove aggregates

Maintaining protein stability throughout purification requires buffer optimization containing glycerol (10-15%), appropriate detergent concentrations, and often specific lipids to maintain the native-like environment. Quality assessment should include SDS-PAGE analysis, Western blotting, and functional assays where possible, despite yvdS being uncharacterized.

How can researchers design experiments to begin characterizing the function of yvdS?

Initial characterization experiments for yvdS should follow established workflows that have proven successful for other membrane proteins in B. subtilis. A systematic approach would include:

  • Bioinformatic analysis to predict potential functions based on sequence homology and structural predictions

  • Generation of knockout mutants to observe phenotypic changes

  • Overexpression studies to identify potential gain-of-function effects

  • Growth experiments under various conditions (nutrient limitations, stress conditions) to identify conditions where yvdS expression is modulated

  • Transport assays with various substrates to identify potential transported molecules

This approach mirrors successful characterization strategies used for other B. subtilis membrane proteins like YveA, which was identified as an L-aspartate transporter through systematic functional studies including growth experiments with L-aspartate as a sole nitrogen source .

What experimental design approaches are most appropriate for determining the substrate specificity of yvdS?

Determining substrate specificity for an uncharacterized membrane protein like yvdS requires a multi-faceted experimental approach:

  • Transport assays using radioactive or fluorescently labeled potential substrates in membrane vesicles or proteoliposomes containing purified yvdS

  • Competition assays with structurally related compounds to identify binding specificity

  • In silico docking studies based on homology models to predict potential substrates

  • Growth phenotype analysis of yvdS knockout versus overexpression strains on various media conditions

  • Sensitivity testing with toxic analogs of potential substrates (similar to the aspartate hydroxamate approach used for YveA characterization)

Statistical considerations for these experiments should include power analyses to determine appropriate sample sizes. Based on previous studies with B. subtilis membrane proteins, a crossover design might be most efficient, requiring approximately 50 samples to achieve 80% power compared to 60-70 samples for parallel or other designs .

How can researchers effectively analyze regulatory mechanisms controlling yvdS expression?

Investigation of yvdS regulation should employ methodologies similar to those used for other B. subtilis genes with unknown regulatory mechanisms:

  • Primer extension analysis to map transcriptional start sites and identify potential promoter regions

  • Northern blot analysis to determine if yvdS is transcribed monocistronically or as part of an operon

  • Reporter fusion constructs (yvdS-lacZ) to quantify expression under various conditions

  • ChIP-seq to identify potential transcription factors binding to the yvdS promoter region

  • Analysis in various regulatory mutant backgrounds (sigB, sigH, relA) to determine pathway dependencies

This systematic approach parallels successful regulatory studies of other B. subtilis genes like yvyD, which was found to be under dual control of σB and σH regulatory factors and influenced by the stringent response . Researchers should pay particular attention to potential stress-responsive elements in the promoter region, as many B. subtilis membrane proteins show altered expression under stress conditions.

What approaches can resolve contradictory data when characterizing yvdS function?

When confronted with contradictory experimental results about yvdS function, researchers should implement a structured troubleshooting process:

  • Conduct meta-analysis of all available data, weighting results based on methodological robustness

  • Perform in silico simulations to reconcile divergent experimental outcomes

  • Design critical experiments specifically targeting the contradictions

  • Implement multiple orthogonal techniques to verify key findings

  • Consider context-dependent effects that might explain apparent contradictions

Statistical approaches should include Bayesian analysis to incorporate prior probabilities derived from related membrane proteins. In silico simulation approaches can help identify the best experimental design to resolve contradictions, optimizing for power, accuracy, and sample size . The contradictions themselves often reveal important biological insights, as seen with other B. subtilis proteins that demonstrate condition-specific functionality.

What structural biology techniques are most informative for an uncharacterized membrane protein like yvdS?

For structural characterization of yvdS, researchers should consider a complementary multi-technique approach:

Sample preparation is critical for success in structural studies of membrane proteins like yvdS. This includes screening multiple detergents, exploring nanodiscs or amphipols as alternatives to traditional detergents, and utilizing lipidic cubic phase methods for crystallization attempts. Researchers should anticipate that yvdS, like other membrane proteins with 12-14 transmembrane segments seen in the APC superfamily proteins of B. subtilis, may require specialized approaches for structure determination .

How can researchers develop reliable assays to measure yvdS activity without prior knowledge of its function?

Developing functional assays for an uncharacterized protein presents unique challenges. A systematic approach includes:

  • Growth phenotype screening: Compare growth rates of wild-type, knockout, and overexpression strains across diverse conditions using techniques like Biolog phenotype microarrays

  • Membrane potential measurements: Use fluorescent dyes to detect changes in membrane potential associated with yvdS activity

  • Generic transport assays: Measure uptake of a diverse panel of labeled substrates in membrane vesicles

  • Toxicity-based screening: Identify compounds that become toxic when yvdS is present/absent

  • Protein interaction studies: Identify binding partners that might indicate function

The most successful approach involves parallel implementation of multiple assay types, as was demonstrated for YveA characterization, where growth experiments, transport assays, and sensitivity to toxic analogs collectively confirmed its function as an aspartate transporter .

What controls are essential when working with recombinant yvdS to ensure experimental validity?

Rigorous experimental design for yvdS studies requires multiple control types:

Control TypePurposeImplementation
Negative controlsExclude false positivesEmpty vector transformants, knockout strains
Positive controlsValidate assay functionalityWell-characterized related protein (e.g., YveA)
Expression controlsVerify protein productionWestern blots, fluorescent tags
Activity controlsEnsure functional proteinKnown functional assays for similar proteins
Vehicle controlsAccount for solvent effectsMatched solvent conditions without protein
Temperature controlsAddress temperature sensitivityParallel experiments at multiple temperatures

Importantly, researchers should include protein topology verification to ensure proper membrane insertion, as incorrect folding can lead to artifactual results. For instance, YveA from B. subtilis has 14 transmembrane segments rather than the typical 12 found in other bacterial APC superfamily members, highlighting the importance of confirming proper membrane topology .

How can researchers differentiate between direct and indirect effects when studying yvdS function?

Distinguishing direct from indirect effects requires a multi-layered experimental approach:

  • Complementation studies: Reintroduce yvdS to knockout strains to verify phenotype restoration

  • Dose-dependency analysis: Establish correlation between yvdS expression levels and observed effects

  • Reconstitution experiments: Purify yvdS and reconstruct activity in artificial membrane systems

  • Rapid response assays: Identify immediate effects following yvdS activation or inhibition

  • Direct binding studies: Demonstrate physical interaction with proposed substrates or partners

Careful time-course experiments are particularly valuable, as they can separate primary from secondary effects. Statistical analysis should account for these temporal relationships, potentially using time-series analysis methods to distinguish causative from consequential changes. This approach has been effective in characterizing other B. subtilis membrane proteins, establishing their direct functions separate from downstream cellular responses .

What computational approaches best predict potential functions of yvdS based on sequence data?

For computational function prediction of yvdS, a hierarchical approach yields the most reliable results:

  • Homology-based analysis: BLAST, HHpred, and HMMER searches against characterized protein databases

  • Structural prediction: AlphaFold2 and RoseTTAFold models to predict tertiary structure

  • Functional domain identification: InterProScan and CDD searches for conserved functional domains

  • Genomic context analysis: Examination of gene neighborhood and potential operonic arrangements

  • Evolutionary analysis: Phylogenetic profiling to identify co-evolving genes suggesting functional relationships

When applying these methods to membrane proteins like yvdS, specialized tools optimized for transmembrane protein analysis should be employed. The topological prediction is particularly important, as transmembrane segment number and arrangement can provide functional clues. For example, the 14-TMS arrangement found in YveA of B. subtilis distinguished it from other APC superfamily members with 12 TMS, establishing it as the prototype for a new family within the superfamily .

How should researchers interpret growth phenotype data from yvdS mutant strains?

Growth phenotype interpretation requires careful consideration of multiple factors:

  • Growth kinetics analysis: Examine lag phase, exponential growth rate, and maximum density separately

  • Media dependency evaluation: Compare results across minimal and complex media formulations

  • Stress response differentiation: Distinguish general stress effects from specific yvdS-related phenotypes

  • Genetic background consideration: Test multiple strain backgrounds to account for compensatory mechanisms

  • Environmental parameter testing: Evaluate temperature, pH, and osmolarity dependencies

Quantitative analysis should include calculation of doubling times and statistical comparison between wild-type and mutant strains. For reference, when characterizing YveA as an aspartate transporter, researchers observed doubling times of approximately 10.4 hours for wild-type B. subtilis using L-aspartate as a sole nitrogen source, compared to 21 hours for the knockout mutant, providing quantitative evidence of its transport function .

How can researchers integrate multiple data types to determine the physiological role of yvdS?

Integrating disparate data sources for yvdS functional determination requires systematic data integration:

  • Weighted evidence approach: Assign confidence scores to different data types

  • Pathway enrichment analysis: Identify biological processes affected by yvdS manipulation

  • Network analysis: Place yvdS in protein-protein interaction and genetic interaction networks

  • Condition-specific modeling: Develop mathematical models of yvdS function under different conditions

  • Comparative systems biology: Compare system-wide effects of yvdS manipulation to those of proteins with known functions

This integrative approach has been effective for other B. subtilis membrane proteins, revealing unexpected connections between seemingly disparate cellular processes. For example, YvyD was found to form a junction between the σB and σH regulons on one side and the σL regulon on the other, a connection that would not have been discovered without integrative analysis .

What high-throughput approaches can accelerate functional characterization of yvdS?

High-throughput methodologies offer opportunities to rapidly advance understanding of yvdS:

  • Transposon sequencing (Tn-seq): Identify genetic interactions by measuring growth effects of genome-wide mutations in yvdS knockout background

  • Proteomics profiling: Quantify proteome-wide changes associated with yvdS manipulation

  • Metabolomics screening: Identify metabolites affected by yvdS presence/absence

  • CRISPR interference screens: Systematically repress genes to identify synthetic phenotypes with yvdS

  • High-content imaging: Visualize subcellular effects of yvdS expression using fluorescent reporters

For membrane proteins like yvdS, specialized high-throughput approaches such as liposome microarray-based assays (LiMA) can test hundreds of potential substrates simultaneously. The integration of these high-throughput data with computational models can significantly accelerate hypothesis generation about yvdS function .

How might yvdS function relate to established membrane protein families in Bacillus subtilis?

Contextualizing yvdS within known protein families requires comparative analysis:

  • Domain architecture comparison with characterized B. subtilis membrane proteins

  • Phylogenetic placement within membrane protein superfamilies

  • Expression pattern correlation with functionally characterized transporters

  • Regulatory network positioning relative to known membrane protein systems

  • Structural motif identification shared with characterized transport proteins

Based on patterns observed in other B. subtilis membrane proteins, yvdS might belong to one of the established transporter superfamilies, such as the APC superfamily that includes 21 recognized paralogues in B. subtilis . Within this context, researchers should pay particular attention to transmembrane topology predictions, as variations in TMS number can indicate functional specialization, as seen with the 14-TMS arrangement of YveA that distinguishes it as the prototype for the AGT family within the APC superfamily .

What are the most promising research directions for elucidating yvdS function?

Based on current knowledge and successful approaches with other uncharacterized B. subtilis membrane proteins, the most promising research directions include:

  • Integrated phenotypic screening across diverse growth conditions

  • Structural determination using cryo-EM with lipid nanodisc reconstitution

  • Systematic substrate transport assays focusing on metabolite classes suggested by bioinformatic analysis

  • Regulatory network mapping using transcriptomics under various stress conditions

  • Protein-protein interaction studies to identify functional partners

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.