Recombinant Bacillus subtilis Uncharacterized membrane protein ywnJ (ywnJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
ywnJ; BSU36540; Uncharacterized membrane protein YwnJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ywnJ
Target Protein Sequence
MNRLLLAGWIFFILLSVCTESFSGMVVSQTVAFHFQPHPDLSQFLVMDFTELTVPEAFIQ KIGHAFSFFVLTYLLWKQRGSIRSAAAGSFAFAFFTEVLQLFFSRNGCIRDVLIDAVGIG LFYGLYVLAKRRKQEMYEKY
Uniprot No.

Target Background

Function
May be important for peptidoglycan remodeling.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YwnJ and how was it initially identified?

YwnJ is an uncharacterized membrane protein in Bacillus subtilis that was identified as part of the σX regulon. It was discovered through RNA polymerase-σ factor affinity (ROMA) experiments where strong signals for the ywnJ gene appeared in reactions using both σX and σW holoenzymes, indicating that it can be transcribed by both these sigma factors . The gene was further confirmed through runoff transcription assays, where B. subtilis σX (EσX) and σW (EσW) holoenzymes both recognized the putative ywnJ promoter, while the RNA polymerase core enzyme (E) alone did not show similar activity .

What is currently known about the molecular characteristics of YwnJ?

Current research indicates that YwnJ is a membrane protein that is part of the cell envelope modification system in B. subtilis. While detailed structural information remains limited, the gene's expression is controlled by extracytoplasmic-function sigma factors that regulate modifications to the cell envelope . The protein shares regulatory patterns with other genes involved in cell envelope modifications, including pbpX (penicillin-binding protein), the dlt operon (D-alanylation of teichoic acids), and the pss ybfM psd operon (phosphatidylethanolamine biosynthesis) . These associations suggest YwnJ may play a role in cell envelope maintenance or modification processes that affect bacterial resistance to antimicrobial compounds.

How does YwnJ differ from other membrane proteins in Bacillus subtilis?

YwnJ is distinguished by its dual regulation by both σX and σW sigma factors, which is relatively uncommon among B. subtilis membrane proteins . While many genes in the B. subtilis genome are regulated by either σX or σW exclusively, ywnJ is one of the few that can be transcribed by both. This dual regulation may indicate a particularly important role in the cell's response to environmental stresses. The promoter of ywnJ contains a CGTC -10 motif with a common extended -10 region of CGTCta, which is characteristic of genes recognized by both σX and σW . This specific promoter structure sets it apart from other membrane proteins regulated by single sigma factors.

How is the expression of ywnJ regulated at the transcriptional level?

The transcriptional regulation of ywnJ occurs primarily through the activity of two extracytoplasmic-function sigma factors: σX and σW. In vitro studies have confirmed that RNA polymerase holoenzymes containing either σX or σW can recognize and initiate transcription from the ywnJ promoter . The promoter recognition by these sigma factors is sequence-specific, with ywnJ containing a CGTC -10 element and an extended -10 region of CGTCta that allows for recognition by both sigma factors . This dual regulation mechanism suggests that ywnJ expression can be activated in response to various environmental conditions that trigger either σX or σW activity, providing flexibility in the cellular response to different stresses.

What experimental approaches are most effective for studying ywnJ expression patterns?

For studying ywnJ expression patterns, several complementary approaches have proven effective:

  • Reporter Fusions: Construction of promoter-cat-lacZ fusions allows for quantitative assessment of ywnJ promoter activity under various conditions. These can be introduced into the SPβ prophage by double-crossover recombination and measured using β-galactosidase assays .

  • In Vitro Transcription Assays: Runoff transcription assays using purified RNA polymerase core enzyme and different sigma factors can determine which holoenzymes recognize the ywnJ promoter .

  • Primer Extension Analysis: This technique can be used to map the transcription start site precisely, as demonstrated for ywnJ using RNA generated by runoff transcription with EσX .

  • DNA Microarray Analysis: This approach can reveal changes in ywnJ expression across different genetic backgrounds or environmental conditions .

  • Real-time PCR: For quantitative assessment of ywnJ transcript levels under various experimental conditions.

The combined use of these methods provides a comprehensive understanding of how ywnJ expression is regulated in response to different genetic backgrounds and environmental stimuli.

What is the relationship between sigma factor activity and ywnJ expression during different growth phases or stress conditions?

The expression of ywnJ correlates with the activity profiles of its regulatory sigma factors, σX and σW. Research indicates that σX activity reaches its maximum during early stationary phase, suggesting that ywnJ expression would be highest during this growth phase . The σX and σW sigma factors are known to respond to various cell envelope stresses, including exposure to antimicrobial peptides, changes in osmolarity, and other environmental challenges that affect the integrity of the cell envelope.

To systematically investigate this relationship, researchers would typically:

  • Monitor ywnJ expression across growth phases using reporter fusions

  • Examine expression changes under various stress conditions (antimicrobial exposure, temperature shifts, pH changes)

  • Compare expression patterns in wild-type strains versus sigX, sigW, and sigX sigW double mutants

  • Correlate changes in ywnJ expression with physiological responses to different stresses

Understanding these relationships provides insight into the conditions under which ywnJ function becomes particularly important for cell envelope modification and stress resistance.

What methods are recommended for purifying recombinant YwnJ protein for structural studies?

Purification of recombinant YwnJ for structural studies presents challenges typical of membrane proteins. A comprehensive purification strategy would include:

  • Expression System Selection: Using an E. coli strain optimized for membrane protein expression (C41/C43) or a B. subtilis-based expression system with controllable promoters.

  • Affinity Tag Design: Incorporating a hexahistidine or Strep-tag, preferably at the C-terminus to minimize interference with membrane insertion.

  • Membrane Extraction: Employing a two-step solubilization process:

    • Initial cell lysis using sonication or French press

    • Membrane fraction isolation by ultracentrifugation

    • Selective solubilization using detergents such as n-dodecyl-β-D-maltoside (DDM), LDAO, or CHAPS

  • Purification Steps:

    • Immobilized metal affinity chromatography (IMAC) for initial capture

    • Size exclusion chromatography for further purification and buffer exchange

    • Optional ion exchange chromatography for removal of contaminants

  • Protein Quality Assessment:

    • SDS-PAGE and Western blotting

    • Mass spectrometry for identity confirmation

    • Dynamic light scattering for homogeneity analysis

For structural studies specifically, incorporating strategies to maintain protein stability such as amphipols or nanodiscs may be necessary for downstream applications like X-ray crystallography or cryo-electron microscopy.

How can researchers determine the membrane topology of YwnJ?

Determining the membrane topology of YwnJ requires a multi-faceted approach combining computational prediction with experimental validation:

  • Computational Prediction:

    • Transmembrane domain prediction using algorithms such as TMHMM, HMMTOP, or TOPCONS

    • Hydropathy plot analysis to identify potential membrane-spanning regions

    • Signal peptide prediction using SignalP

  • Experimental Validation:

    • PhoA/LacZ Fusion Approach: Creating a series of truncated YwnJ-PhoA and YwnJ-LacZ fusions at different positions. PhoA is active when located in the periplasm, while LacZ is active in the cytoplasm, allowing determination of the orientation of different protein segments.

    • Cysteine Accessibility Method: Introducing cysteine residues at various positions and assessing their accessibility to membrane-impermeable sulfhydryl reagents.

    • Protease Protection Assays: Exposing membrane vesicles containing YwnJ to proteases, followed by mass spectrometry analysis to identify protected fragments.

    • Epitope Mapping: Incorporating epitope tags at different positions and determining their accessibility through immunofluorescence microscopy or flow cytometry.

  • Structural Analysis:

    • Circular dichroism spectroscopy to estimate secondary structure content

    • NMR spectroscopy for detailed structural information of specific domains

By combining these approaches, researchers can generate a comprehensive topology model of YwnJ within the membrane, identifying cytoplasmic, transmembrane, and extracellular domains.

What functional assays are most appropriate for investigating YwnJ's role in cell envelope modification?

Based on its association with genes involved in cell envelope modification and antimicrobial peptide resistance, several functional assays can be employed to investigate YwnJ's specific role:

  • Antimicrobial Peptide Susceptibility Testing:

    • Minimum inhibitory concentration (MIC) determination with wild-type versus ywnJ deletion strains

    • Time-kill kinetics assays with various cationic antimicrobial peptides

    • Membrane permeabilization assays using fluorescent dyes (SYTOX Green, propidium iodide)

  • Cell Surface Charge Analysis:

    • Cytochrome c binding assay to assess net surface charge

    • Zeta potential measurements of whole cells

    • Electrophoretic mobility studies comparing wild-type and ywnJ mutant strains

  • Membrane Composition Analysis:

    • Lipidomic profiling using mass spectrometry to detect changes in membrane lipid composition

    • Analysis of phosphatidylethanolamine content and distribution

    • Fluorescent membrane probe studies to examine membrane organization

  • Cell Envelope Integrity Assessment:

    • Autolysis rate determination in the presence of Triton X-100

    • Osmotic stress sensitivity assays

    • Electron microscopy to visualize cell envelope structural changes

  • Protein Interaction Studies:

    • Bacterial two-hybrid screening to identify interaction partners

    • Co-immunoprecipitation studies with other cell envelope modification proteins

    • Fluorescence resonance energy transfer (FRET) to detect protein-protein interactions in the membrane

These complementary approaches would provide insights into YwnJ's functional role in modifying the cell envelope and contributing to antimicrobial resistance mechanisms.

How does ywnJ contribute to Bacillus subtilis resistance against cationic antimicrobial peptides?

The contribution of YwnJ to B. subtilis resistance against cationic antimicrobial peptides likely stems from its role in modifying the cell envelope charge. Based on its co-regulation with other genes involved in similar processes, YwnJ may function as part of a coordinated response system that reduces the net negative charge of the cell envelope, thereby decreasing the electrostatic attraction between cationic peptides and the bacterial surface .

Research has established that the σX regulon, which includes ywnJ, plays a significant role in antimicrobial peptide resistance. The sigX mutant strain shows increased sensitivity to cationic antimicrobial peptides . Other members of this regulon, such as the dlt operon and pss ybfM psd operon, introduce positive charges into the cell envelope through D-alanylation of teichoic acids and incorporation of phosphatidylethanolamine into the membrane, respectively .

To specifically elucidate YwnJ's contribution, researchers should:

  • Compare antimicrobial peptide susceptibility profiles of wild-type, ywnJ deletion, and complemented strains

  • Examine membrane charge characteristics in these strains using cytochrome c binding assays

  • Investigate whether YwnJ expression is induced upon exposure to sublethal concentrations of antimicrobial peptides

  • Determine if YwnJ interacts with or influences the activity of other known resistance factors

What is the relationship between YwnJ and other members of the σX and σW regulons?

YwnJ exists within a complex regulatory network involving overlapping control by the σX and σW regulons. This relationship can be characterized as follows:

FeatureYwnJOther σX-regulated genesσW-regulated genesDual-regulated genes
Promoter motifCGTC with extended -10 region of CGTCtaCGAC or CGTCCGTaCGTC
RegulationσX and σWPrimarily σXPrimarily σWBoth σX and σW
FunctionCell envelope modification (putative)Cell envelope modification, lipid metabolismAntibiotic resistance, detoxificationVaried
Examples of co-regulated genes-dltA, pssA, pbpX (partial σW)yteIdltA, pssA (in reactions only)

The functional relationship between YwnJ and other regulon members likely involves coordination in modifying the cell envelope in response to environmental stresses. For example, while the dlt operon adds positive charges to teichoic acids and the pss operon introduces phosphatidylethanolamine into the membrane, YwnJ may participate in a complementary modification process or facilitate the activity of these other systems .

To fully understand these relationships, systematic genetic interaction studies (e.g., synthetic lethality screening, epistasis analysis) between ywnJ and other regulon members would be informative, potentially revealing functional redundancies or dependencies.

Under what environmental conditions is YwnJ expression most significant?

Based on its regulation by σX and σW factors, YwnJ expression is likely most significant under conditions that activate these sigma factors, particularly:

  • Cell Envelope Stress Conditions:

    • Exposure to cationic antimicrobial peptides

    • Presence of cell wall-active antibiotics

    • Alkaline pH stress

    • Membrane-disrupting agents

  • Growth Phase-Dependent Expression:

    • Early stationary phase (when σX activity reaches its maximum)

    • Transition phase between exponential and stationary growth

  • Other Environmental Conditions:

    • High salinity environments

    • Temperature shifts

    • Oxidative stress conditions

To systematically characterize the environmental regulation of YwnJ expression, researchers should employ reporter fusion constructs to monitor promoter activity across diverse growth conditions. Time-course studies could be particularly valuable in identifying specific environmental triggers and determining the kinetics of YwnJ induction in response to various stresses.

How can CRISPR-Cas9 technology be used to study YwnJ function in Bacillus subtilis?

CRISPR-Cas9 technology offers powerful approaches for studying YwnJ function through precise genetic manipulation:

  • Gene Knockout and Knockdown Studies:

    • Generation of clean ywnJ deletion mutants without antibiotic markers

    • Creation of conditional knockdown strains using CRISPR interference (CRISPRi) with a catalytically inactive Cas9 (dCas9) to regulate ywnJ expression levels

    • Design of multiple guide RNAs targeting different regions of ywnJ to ensure complete repression

  • Domain Function Analysis:

    • Introduction of point mutations to alter specific amino acids in functional domains

    • Creation of truncation variants to identify essential regions

    • Engineering of chimeric proteins by swapping domains with related proteins

  • Promoter Modification:

    • Precise editing of the ywnJ promoter sequence to alter σX or σW binding sites

    • Introduction of inducible promoter elements for controlled expression studies

    • Creation of reporter fusions at the native locus

  • Tagging Strategies:

    • C-terminal or N-terminal tagging of the endogenous ywnJ gene with fluorescent proteins or affinity tags

    • Introduction of split fluorescent protein tags for protein interaction studies

    • Addition of degron tags for controlled protein degradation

Implementation protocol would involve:

  • Design of guide RNAs with minimal off-target effects

  • Construction of repair templates containing desired modifications

  • Transformation into B. subtilis using established protocols

  • Screening of transformants using PCR, sequencing, and functional assays

  • Phenotypic characterization under various stress conditions

This approach allows for precise genetic manipulation without leaving resistance markers or other genetic scars that might confound phenotypic analysis.

What proteomics approaches can reveal the protein interaction network of YwnJ?

Understanding YwnJ's protein interaction network requires sophisticated proteomics approaches:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Expression of epitope-tagged YwnJ (His, FLAG, or Strep-tag)

    • Cross-linking to stabilize transient interactions

    • Membrane solubilization with appropriate detergents

    • Affinity purification of YwnJ complexes

    • Mass spectrometric identification of co-purified proteins

    • Quantitative comparison with control samples to identify specific interactors

  • Proximity-Dependent Labeling:

    • Fusion of YwnJ with BioID, TurboID, or APEX2 enzymes

    • In vivo biotinylation of proximal proteins

    • Streptavidin purification and MS identification

    • This approach is particularly valuable for capturing weak or transient interactions in the native cellular context

  • Chemical Cross-Linking MS (XL-MS):

    • Treatment of intact cells or membrane fractions with cross-linking agents

    • Digestion and enrichment of cross-linked peptides

    • High-resolution MS analysis to identify cross-linked residues

    • Computational modeling to generate structural insights from cross-linking constraints

  • Protein Correlation Profiling:

    • Fractionation of membrane complexes under native conditions

    • Quantitative proteomics across fractions

    • Identification of proteins with similar elution profiles as YwnJ

    • This approach can identify functional complexes without requiring direct physical interaction

  • Data Analysis and Validation:

    • Application of computational tools to filter for high-confidence interactions

    • Network analysis to identify functional clusters

    • Validation of key interactions through targeted approaches (bacterial two-hybrid, co-immunoprecipitation)

    • Integration with existing interactome databases

These complementary approaches would provide a comprehensive view of YwnJ's interactome in the context of cell envelope modification processes.

How can systems biology approaches integrate YwnJ function into broader cellular processes?

Systems biology offers powerful frameworks for understanding YwnJ's function within broader cellular processes:

  • Multi-omics Integration:

    • Combining transcriptomics, proteomics, and metabolomics data from wild-type and ywnJ mutant strains

    • Integrating data across multiple stress conditions and growth phases

    • Applying computational approaches to identify correlations between YwnJ expression and global cellular responses

    • Construction of predictive models for YwnJ-dependent processes

  • Regulatory Network Reconstruction:

    • ChIP-seq or CUT&RUN experiments to identify genome-wide binding profiles of σX and σW

    • Integration with transcriptome data to define direct and indirect effects

    • Network modeling to understand the hierarchical organization of the envelope stress response

    • Identification of feedback mechanisms and regulatory motifs

  • Flux Analysis Approaches:

    • Metabolic flux analysis to determine how YwnJ affects membrane lipid metabolism

    • Isotope labeling experiments to track changes in phospholipid synthesis and turnover

    • Quantitative assessment of how YwnJ-dependent processes affect cellular energetics

  • Phenotypic Profiling:

    • High-throughput phenotypic screening of ywnJ mutants across diverse conditions

    • Creation of genetic interaction maps through systematic double mutant analysis

    • Chemogenomic profiling to identify chemical sensitivities linked to YwnJ function

  • Computational Modeling:

    • Development of mathematical models incorporating YwnJ function in cell envelope homeostasis

    • In silico prediction of cellular responses to environmental stresses

    • Simulation of antimicrobial peptide resistance mechanisms

Such integrated approaches would position YwnJ within the broader context of B. subtilis stress responses and cell envelope homeostasis, potentially revealing unexpected connections to other cellular processes such as cell division, sporulation, or biofilm formation.

What are the main challenges in studying membrane proteins like YwnJ, and how can they be addressed?

Studying membrane proteins like YwnJ presents several significant challenges that require specialized approaches:

  • Expression and Purification Challenges:

    • Challenge: Low expression levels and inclusion body formation

    • Solution: Use specialized expression systems like C41/C43 E. coli strains, codon optimization, fusion partners (MBP, SUMO), and low-temperature induction protocols

    • Challenge: Maintaining protein stability during extraction and purification

    • Solution: Screen multiple detergents (DDM, LDAO, CHAPS), use styrene-maleic acid lipid particles (SMALPs), or nanodiscs to maintain a native-like lipid environment

  • Structural Analysis Difficulties:

    • Challenge: Obtaining sufficient protein for structural studies

    • Solution: Implement high-yield expression systems, scale-up protocols, and efficient purification strategies

    • Challenge: Growing crystals for X-ray crystallography

    • Solution: Use lipidic cubic phase crystallization, antibody fragment crystallization chaperones, or cryo-EM as an alternative approach

  • Functional Characterization Barriers:

    • Challenge: Developing relevant functional assays

    • Solution: Implement cell-based assays measuring antimicrobial resistance, membrane integrity, or surface charge alterations

    • Challenge: Distinguishing direct from indirect effects

    • Solution: Use reconstitution experiments with purified components in proteoliposomes or defined systems

  • Redundancy and Compensation Issues:

    • Challenge: Genetic compensation obscuring phenotypes

    • Solution: Generate conditional or inducible mutants, use CRISPRi for acute depletion, create multiple deletion strains to address redundancy

By systematically addressing these challenges with appropriate methodological approaches, researchers can overcome the inherent difficulties in studying membrane proteins like YwnJ and gain meaningful insights into their structure and function.

How can contradictory experimental results about YwnJ function be reconciled and interpreted?

Contradictory experimental results about membrane proteins like YwnJ are common due to their complex nature. A systematic approach to reconciliation includes:

  • Methodological Comparison:

    • Evaluate differences in experimental conditions (media composition, growth phase, strain backgrounds)

    • Assess detection methods and their sensitivity/specificity limits

    • Consider whether in vitro systems adequately represent in vivo conditions

  • Genetic Background Analysis:

    • Examine strain differences that may affect regulatory networks

    • Consider the presence of suppressor mutations that may arise during strain construction

    • Evaluate the impact of marker genes or expression tags on protein function

  • Context-Dependent Function:

    • Investigate whether YwnJ function varies with environmental conditions

    • Consider that YwnJ may have different roles depending on growth phase or stress exposure

    • Examine potential moonlighting functions in different cellular compartments

  • Integration of Multiple Data Types:

    Data TypeStrengthLimitationIntegration Strategy
    GeneticDirect causalityCompensation effectsCombine with biochemical validation
    BiochemicalDirect mechanistic insightsIn vitro artifactsVerify with in vivo experiments
    StructuralMolecular mechanism detailsStatic snapshotsComplement with dynamic analyses
    PhysiologicalWhole-cell relevanceComplex interpretationUse as phenotypic validation
    ComputationalHypothesis generationRequires validationGuide experimental design
  • Systematic Validation:

    • Design experiments specifically to test competing hypotheses

    • Use orthogonal approaches to verify controversial findings

    • Implement appropriate controls to rule out technical artifacts

By applying these reconciliation strategies, researchers can develop a more nuanced understanding of YwnJ function that accommodates seemingly contradictory observations and places them in a broader biological context.

What are the future research directions that could lead to a comprehensive understanding of YwnJ function?

Future research directions for comprehensive understanding of YwnJ function should address current knowledge gaps through innovative approaches:

  • Structural Biology Advances:

    • Determination of high-resolution structure using cryo-EM or X-ray crystallography

    • Application of integrative structural biology combining multiple techniques (NMR, SAXS, cross-linking MS)

    • Computational modeling and molecular dynamics simulations to understand conformational dynamics

  • Single-Cell Analysis:

    • Investigation of cell-to-cell variability in YwnJ expression using microfluidics and fluorescent reporters

    • Correlation of YwnJ levels with antimicrobial resistance at the single-cell level

    • Spatio-temporal dynamics of YwnJ localization during stress responses

  • In situ Functional Analysis:

    • Development of specific YwnJ activity assays in native membranes

    • Application of FRET-based biosensors to monitor YwnJ-dependent changes in membrane properties

    • Use of super-resolution microscopy to determine membrane domain organization

  • Systematic Interaction Mapping:

    • Comprehensive genetic interaction screening with the entire B. subtilis genome

    • Chemical-genetic profiling to identify compounds that specifically target YwnJ-dependent processes

    • Interspecies comparison of YwnJ homologs and their functional networks

  • Translation to Applied Research:

    • Exploration of YwnJ as a potential target for antimicrobial development

    • Investigation of YwnJ's role in biofilm formation and persistence

    • Assessment of YwnJ's contribution to B. subtilis adaptation in different ecological niches

These research directions, pursued in parallel with continued characterization of the basic properties of YwnJ, would provide a comprehensive understanding of this membrane protein's function in B. subtilis physiology and stress response mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.