Recombinant Bacillus subtilis Uncharacterized MscS family protein YfkC (yfkC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yfkC; BSU07940; Uncharacterized MscS family protein YfkC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-280
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yfkC
Target Protein Sequence
MRMKETLTEIFQNKIVDILLVAVILWIGVFIINRLVQLFFKRTDFIEEKKEKTIESLVRS VTQYTATIGFIFYVISLFVHDFGKILAGAGVAGIVIGFGAQSLIKDVLAGVFLIYERQLH KGDYVTVNNLFNGTVEEIGLRSLQIREWSGKLLTISNGEVRQIENYNIDFMRITESFLIS FKEDPDRVYSVLEEACDMLNEELRDSLKRDEFGNPTEPFQIHGITALNKINRGVEFTVKG MVKDDDYFSASLAVRRVLVRQLYQNNVQMLEEAVRIERTQ
Uniprot No.

Target Background

Function
Plays a potential role in resistance to osmotic downshock.
Database Links
Protein Families
MscS (TC 1.A.23) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is YfkC and which protein family does it belong to?

    YfkC is an uncharacterized protein from Bacillus subtilis that belongs to the MscS (Mechanosensitive channel of Small conductance) family. The MscS family is one of two ubiquitous families of mechanosensitive channel proteins recognized across various organisms . While YfkC's function has been partially elucidated through suppressor mutations, it remains classified as "uncharacterized" in standard protein databases .

    Methodology: Researchers typically identify protein family membership through sequence homology analysis and conserved domain identification. For YfkC, comparative analysis with known MscS family members reveals shared structural motifs, particularly in the transmembrane regions that form the channel pore.

  • What structural features characterize YfkC as an MscS family protein?

    YfkC shares the characteristic structural organization of MscS family proteins, particularly the three conserved C-terminal transmembrane segments (TMSs). The third of these TMSs contains a 20-residue motif that is shared with the channel-forming TMS of MscL proteins . This conservation pattern strongly suggests that this C-terminal TMS serves as the channel-forming helix in YfkC.

    The R42W mutation that significantly affects YfkC function is located at the end of the first transmembrane helix and potentially alters the relative positioning of transmembrane helices 1 and 2 . This structural arrangement is crucial for channel gating and selectivity.

    Methodology: Structure prediction algorithms, hydropathy plots, and targeted mutagenesis are typically employed to identify and characterize these domains. Membrane topology mapping using reporter fusions can validate computational predictions.

  • What is the functional role of YfkC in Bacillus subtilis physiology?

    YfkC functions as a mechanosensitive channel involved in glutamate homeostasis in B. subtilis. This role becomes particularly evident in strains lacking c-di-AMP, where glutamate becomes toxic. Research has demonstrated that a specific R42W mutation in YfkC (designated YfkC*) facilitates glutamate export, helping to alleviate this toxicity .

    Experimental data from GC-MS analysis reveals that strains with the YfkC* mutation show:

    StrainIntracellular Glutamate (μg/OD600 and ml)Extracellular Glutamate (μg/OD600 and ml)
    Wild type (168)2.81.0
    ΔyfkC2.81.0
    yfkC* (R42W)1.71.3
    yfkC* plsC*1.42.3

    Methodology: Metabolite analysis using GC-MS to quantify intracellular and extracellular glutamate levels, combined with growth phenotyping under various conditions.

  • What experimental approaches are used to study YfkC function?

    Several complementary approaches have been used to investigate YfkC function:

    • Genetic manipulation: Creating deletion mutants (ΔyfkC) and point mutants (yfkC* with R42W substitution)

    • Suppressor isolation: Identifying mutations that overcome specific phenotypes, such as glutamate toxicity in c-di-AMP-free strains

    • Growth phenotyping: Testing various strains on different media compositions to assess phenotypes

    • Metabolite analysis: Using GC-MS to measure glutamate concentrations inside cells and in the culture medium

    • Whole-genome sequencing: Identifying mutations in suppressor strains to understand genetic interactions

    • Sequence alignment: Comparing YfkC with other MscS family members to identify conserved regions

    Methodology: These approaches should be combined in a systematic way, starting with phenotypic characterization of knockout strains, followed by suppressor analysis and detailed biochemical studies.

  • How does YfkC compare to other mechanosensitive channels in bacteria?

    YfkC is part of the MscS family, which exhibits considerably more diversity than the MscL family. While MscL forms homopentameric channels with a well-defined structure , MscS family members:

    • Vary in length from less than 200 to over 1,100 residues

    • Have topologies ranging from 3 to 11 putative transmembrane segments

    • Share three conserved C-terminal transmembrane segments

    • Exhibit a 20-residue conserved motif in the third conserved TMS that is also found in MscL proteins

    The specific function of YfkC in glutamate export appears to be specialized, particularly when carrying the R42W mutation. This functional specificity distinguishes it from other mechanosensitive channels like MscL which primarily function in osmotic regulation.

    Methodology: Comparative electrophysiology, ion selectivity assays, and cross-complementation studies between different MS channels can reveal functional differences.

Advanced Research Questions

  • How does the R42W mutation affect YfkC channel properties and glutamate export?

    The R42W mutation in YfkC (designated YfkC*) significantly enhances its ability to export glutamate. This specific mutation was independently identified in three different suppressor strains that overcame glutamate toxicity in a c-di-AMP-free background, suggesting strong selective pressure .

    The mutation is located at the end of the first transmembrane helix and likely alters the positioning of transmembrane helices 1 and 2, affecting channel gating or selectivity . This structural change enables increased glutamate export, as evidenced by:

    • Reduced intracellular glutamate (1.7 μg/OD600/ml compared to 2.8 in wild type)

    • Increased extracellular glutamate (1.3 μg/OD600/ml compared to 1.0 in wild type)

    Interestingly, the R42W mutation alone is insufficient to overcome glutamate toxicity in c-di-AMP-free strains; it requires additional mutations, often in lipid biosynthesis genes .

    Methodology: Patch-clamp electrophysiology with purified and reconstituted YfkC variants would provide direct evidence of altered channel properties. Site-directed mutagenesis of nearby residues could map the functional domain important for glutamate transport.

  • What is the relationship between YfkC function and c-di-AMP signaling in B. subtilis?

    C-di-AMP plays a major role in potassium homeostasis in B. subtilis, and strains lacking this signaling molecule (Δdac mutants) are sensitive to both high potassium concentrations and glutamate . YfkC function intersects with c-di-AMP signaling pathways in the regulation of glutamate homeostasis.

    Growth characteristics of different strains in various media reveal this relationship:

    StrainMin. Medium + 0.1 mM K+ + NH4+Min. Medium + 0.1 mM K+ + GluMin. Medium + 5 mM K+ + NH4+Min. Medium + 5 mM K+ + GluLB Medium
    Δdac+----
    Δdac ΔyfkC+----
    Δdac yfkC*+----
    Δdac yfkC* plsC*+++++
    Δdac nhaK*+-+--

    Note: "+" indicates growth, "-" indicates no growth

    Methodology: Transcriptomic and proteomic analysis of wild-type versus c-di-AMP-deficient strains with various YfkC alleles would reveal regulatory networks connecting these systems. Measuring intracellular c-di-AMP levels in different YfkC backgrounds could identify potential feedback mechanisms.

  • How do membrane properties and lipid composition affect YfkC activity?

    The research reveals a critical relationship between membrane properties and YfkC function. Mutations in lipid biosynthesis genes (such as plsC, which encodes 1-acylglycerol-3-phosphate acyltransferase) were consistently found alongside the yfkC* mutation in suppressor strains .

    The combination of altered lipid composition and the R42W mutation in YfkC results in enhanced glutamate export:

    • YfkC* PlsC* double mutants showed greater reduction in intracellular glutamate (1.4 vs 1.7 μg/OD600/ml)

    • YfkC* PlsC* double mutants demonstrated substantially increased extracellular glutamate (2.3 vs 1.3 μg/OD600/ml)

    This indicates a functional interaction between mechanosensitive channels and membrane lipids, where the altered membrane properties due to plsC mutations enhance the effects of the R42W substitution in YfkC .

    Methodology: Lipidomic analysis of wild-type versus suppressor strains would identify specific lipid changes. Reconstitution of purified YfkC and YfkC* in liposomes with defined lipid compositions would directly test how specific lipids affect channel function.

  • What molecular mechanisms govern YfkC activation in response to membrane tension?

    While the search results don't explicitly detail the molecular mechanisms of YfkC activation, we can infer principles based on what's known about MscS family proteins:

    • The third C-terminal TMS likely serves as the channel-forming helix in a homooligomeric structure

    • The conserved residue pattern suggests a common gating mechanism with other mechanosensitive channels

    • The channel likely responds to membrane tension through conformational changes in its transmembrane domains

    The R42W mutation, located at the end of the first transmembrane helix, likely alters the tension-sensing properties of the channel by changing the interaction between transmembrane helices 1 and 2 . This structural change, particularly when combined with altered membrane properties, enhances glutamate export.

    Methodology: Molecular dynamics simulations of wild-type and mutant YfkC in lipid bilayers under tension would provide insights into conformational changes during gating. FRET-based tension sensors could be developed to measure YfkC conformational changes in vivo.

  • How can recombinant YfkC be utilized for structure-function studies?

    Recombinant Bacillus subtilis YfkC protein can be leveraged for detailed structure-function studies through several approaches:

    • Site-directed mutagenesis: Systematic mutation of key residues, starting with those surrounding R42, to map regions critical for channel function

    • Domain swapping: Creating chimeric proteins between YfkC and other MscS family members to identify regions responsible for specific functions

    • In vitro reconstitution: Purifying the protein and reconstituting it in liposomes with defined lipid compositions to study how membrane properties affect channel activity

    • Structural biology approaches: Using techniques like cryo-EM or X-ray crystallography to determine the three-dimensional structure of YfkC in different conformational states

    • Electrophysiology: Patch-clamp studies of reconstituted YfkC to directly measure channel conductance, ion selectivity, and gating properties

    Methodology: Expression and purification protocols should be optimized for high yield and purity, potentially using affinity tags that can be removed for functional studies. Detergent screening is critical for maintaining protein stability during purification.

  • What genetic approaches can be used to study YfkC's role in bacterial stress responses?

    Several genetic approaches have proven valuable for studying YfkC's role in stress responses:

    • Suppressor mutation analysis: Identifying mutations that restore growth under stressful conditions (like glutamate toxicity in c-di-AMP-free strains)

    • Construction of double and triple mutants: Creating strains with combinations of mutations in YfkC and related pathways to study genetic interactions

    • Reporter gene fusions: Developing fluorescent or enzymatic reporters linked to YfkC expression to monitor regulation under various stress conditions

    • Conditional expression systems: Using inducible promoters to control YfkC expression levels during stress experiments

    • Comprehensive phenotyping: Testing growth under various stressors (osmotic, ionic, pH, etc.) to identify conditions where YfkC function becomes critical

    Methodology: Transposon mutagenesis libraries combined with high-throughput phenotyping can identify genes that interact with YfkC. The Δdac background serves as a sensitized genetic background for revealing YfkC functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.