Recombinant Bacillus subtilis Uncharacterized protein ybbP (ybbP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your own preparations.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. Please specify your required tag type for preferential development.
Synonyms
cdaA; ybbP; BSU01750; Cyclic di-AMP synthase CdaA; c-di-AMP synthase; Diadenylate cyclase; DAC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
cdaA
Target Protein Sequence
MAFEDIPFLQYLGNAVDILLVWYVIYKLIMVIRGTKAVQLLKGIVVIVLVRMASQYLGLS TLQWLMDQAITWGFLAIIIIFQPELRRALEQLGRGRFFSRSGTPVEEAQQKTIEAITKAI NYMAKRRIGALLTIERDTGMGDYIETGIPLNAKVSSELLINIFIPNTPLHDGAVIMKNNE IAAAACYLPLSESPFISKELGTRHRAAVGISEVTDSLTIIVSEETGGVSVAKNGDLHREL TEEALKEMLEAEFKKNTRDTSSNRWYWRGKKNG
Uniprot No.

Target Background

Function

This bacterial protein is one of three diadenylate cyclase (DAC) paralogs. It likely catalyzes the condensation of two ATP molecules into cyclic di-AMP (c-di-AMP). Expression in E. coli results in c-di-AMP synthesis, suggesting it is the primary c-di-AMP producer in the cell, possibly regulating peptidoglycan synthesis. In Bacillus subtilis, c-di-AMP acts as a second messenger involved in growth, DNA repair, and cell wall homeostasis; excess c-di-AMP is toxic.

Database Links
Protein Families
Adenylate cyclase family, DacA/CdaA subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does CdaA/ybbP differ from other diadenylate cyclases in Bacillus subtilis?

B. subtilis encodes three distinct diadenylate cyclases with different characteristics:

Diadenylate CyclaseOriginal NameCellular LocalizationExpression ConditionsFunction
CdaAYbbPMembrane-associatedNormal growth conditionsPart of cell wall metabolism
CdaSYojJCytoplasmicSporulation-specificProvides c-di-AMP for spores
DisAYacKCytoplasmicDNA damage responseDNA integrity scanning protein

These enzymes are expressed under different conditions in different cell compartments and localize to distinct positions in the cell. CdaA/ybbP appears to be the primary diadenylate cyclase during normal growth conditions, while CdaS becomes important during sporulation .

What are the optimal conditions for expressing recombinant ybbP/CdaA protein?

Based on research protocols for similar B. subtilis proteins, optimal expression of recombinant ybbP/CdaA can be achieved through:

  • Expression system selection:

    • E. coli BL21(DE3) is commonly used for initial expression attempts

    • B. subtilis strain 168 derivatives might provide better folding for native proteins

  • Culture conditions:

    • Growth medium: LB or minimal media with glucose as carbon source

    • Temperature: 30°C during induction phase (reduces inclusion body formation)

    • pH: 7.0-7.5

    • Induction: 0.1-0.5 mM IPTG for T7-based systems

  • Harvest timing:

    • Harvest cells during mid to late exponential phase for optimal yield

    • Implement an early harvest protocol for membrane proteins to enhance expression level

  • Storage conditions:

    • Store in Tris-based buffer with 50% glycerol at -20°C

    • For extended storage, conserve at -80°C

    • Avoid repeated freezing and thawing; store working aliquots at 4°C for up to one week

What are effective strategies for purifying functional ybbP/CdaA protein while maintaining its enzymatic activity?

For effective purification of functional ybbP/CdaA while preserving its enzymatic activity:

  • Cell lysis and membrane protein extraction:

    • Gentle lysis using lysozyme (0.5 mg/ml) in combination with mild detergents

    • For membrane-associated proteins like ybbP, use detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% for solubilization

  • Affinity purification options:

    • His-tag purification using Ni-NTA columns with imidazole gradient elution

    • Strep-tag purification using StrepTactin columns with desthiobiotin as eluent

    • Addition of 5-10% glycerol in all buffers helps stabilize the protein

  • Activity preservation measures:

    • Maintain samples at 4°C throughout purification

    • Include protease inhibitor cocktail in all buffers

    • Add 1-5 mM dithiothreitol (DTT) to prevent oxidation of cysteine residues

    • For membrane proteins, maintain detergent above critical micelle concentration in all buffers

  • Quality control:

    • Verify purity using SDS-PAGE

    • Confirm identity through Western blotting or mass spectrometry

    • Assess enzymatic activity using c-di-AMP detection assays

How can researchers effectively study protein-protein interactions involving ybbP/CdaA?

Several complementary methods have proven effective for studying ybbP/CdaA interactions:

  • Bacterial two-hybrid analysis:

    • Ideal for identifying primary protein-protein interactions

    • Based on interaction-mediated reconstruction of adenylate cyclase activity

    • Advantages: in vivo detection, relatively simple setup

    • Limitations: may miss transient or weak interactions

  • Strep-protein interaction experiment (SPINE) technology:

    • Isolate protein complexes from B. subtilis cells using cross-linking

    • Protocol: Treat growing cultures with formaldehyde (0.6%, w/v, 20 min)

    • Purify Strep-tagged proteins and potential partners using StrepTactin columns

    • Identify interacting proteins by Western blot or mass spectrometry

  • Structure-based prediction approaches:

    • Use homology models combined with geometric relationships

    • Apply Bayesian network classifiers trained on high-confidence interaction sets

    • Integrate multiple non-structural clues to improve prediction accuracy

    • Validation: Test predictions using in vitro or in vivo experimental methods

  • Reverse-polarity activity-based protein profiling (RP-ABPP):

    • Deploy nucleophilic probes with "click" chemistry into living cells

    • Capture, immunoprecipitate, and identify protein-bound electrophiles

    • Particularly useful for characterizing electrophilic post-translational modifications

Key known interaction: ybbP/CdaA activity is modulated through protein-protein interaction with the regulator protein YbbR (renamed CdaR) .

What structural features of ybbP/CdaA are critical for its diadenylate cyclase activity?

Several structural features are essential for ybbP/CdaA's enzymatic function:

  • DAC (diadenylate cyclase) domain:

    • Contains the catalytic core responsible for c-di-AMP synthesis

    • Conserved among different bacterial species

    • Critical for converting ATP to c-di-AMP

  • Membrane association regions:

    • N-terminal transmembrane helices anchor the protein to the cell membrane

    • This localization is crucial for its role in cell wall metabolism

    • Proper membrane integration is necessary for full enzymatic activity

  • Protein-protein interaction interfaces:

    • Specifically the interaction site with CdaR (YbbR)

    • These interactions modulate enzymatic activity through allosteric regulation

  • Active site residues:

    • Key amino acids involved in substrate binding and catalysis

    • Mutations in these residues can significantly alter or abolish enzyme activity

When designing experiments with recombinant ybbP/CdaA, researchers should preserve these structural elements to maintain native activity. For membrane-associated proteins like ybbP, proper folding and activity often depend on maintaining the integrity of transmembrane domains through appropriate detergent selection during purification.

How can researchers measure the diadenylate cyclase activity of recombinant ybbP/CdaA?

Several robust methods exist for assessing the enzymatic activity of ybbP/CdaA:

  • HPLC-based detection of c-di-AMP production:

    • Incubate purified ybbP/CdaA with ATP substrate

    • Extract nucleotides using perchloric acid precipitation

    • Analyze reaction products by reverse-phase HPLC

    • Quantify c-di-AMP production using absorption at 260 nm

    • Advantages: Quantitative, highly specific

    • Limitations: Requires specialized equipment

  • Radiolabeled ATP assay:

    • Incubate enzyme with [α-32P]-ATP

    • Separate reaction products by thin-layer chromatography

    • Visualize and quantify using phosphorimaging

    • Advantages: High sensitivity

    • Limitations: Requires radioactive materials handling

  • Coupled enzyme assays:

    • Link c-di-AMP production to a secondary reaction producing a colorimetric or fluorometric readout

    • Monitor in real-time using spectrophotometry

    • Advantages: Continuous monitoring of reaction kinetics

    • Limitations: Potential interference from coupling enzymes

  • c-di-AMP-specific biosensors:

    • Utilize c-di-AMP binding proteins fused to reporter proteins

    • Measure fluorescence or luminescence changes upon c-di-AMP binding

    • Advantages: Can be adapted for high-throughput screening

    • Limitations: May have limited dynamic range

When performing these assays, it's critical to include appropriate controls, such as heat-inactivated enzyme and known diadenylate cyclase inhibitors.

What is the relationship between ybbP/CdaA activity and bacterial cell wall metabolism?

The relationship between ybbP/CdaA and cell wall metabolism is complex and multifaceted:

  • Association with the conserved cda-glm module:

    • ybbP/CdaA is part of an essential gene module involved in cell wall metabolism

    • This association suggests a direct role in regulating peptidoglycan synthesis

  • Cell wall integrity maintenance:

    • c-di-AMP produced by CdaA influences cell wall composition and thickness

    • Proper c-di-AMP levels are crucial for maintaining cell wall integrity during growth

    • Both too little and too much c-di-AMP are harmful to cells

  • Interaction with peptidoglycan synthesis pathways:

    • Research using cryo-FIB-ET (cryo-focused ion beam electron tomography) has shown that peptidoglycan is not completely degraded during cellular processes

    • This suggests that c-di-AMP signaling may regulate the balance between peptidoglycan synthesis and degradation

  • Sporulation and cell wall remodeling:

    • During sporulation, significant cell wall remodeling occurs

    • While CdaS is the sporulation-specific diadenylate cyclase, CdaA/ybbP may play roles during early sporulation stages

    • Proper c-di-AMP regulation is essential for mother cell engulfment of the forespore

Researchers investigating this relationship should consider employing cell wall-specific staining techniques, peptidoglycan analysis methods, and microscopy approaches such as cryo-FIB-ET to visualize structural changes associated with altered ybbP/CdaA activity.

How do mutations in ybbP/CdaA affect cyclic di-AMP homeostasis and bacterial phenotypes?

Understanding the effects of ybbP/CdaA mutations requires comprehensive analysis:

  • Critical mutations and their consequences:

Mutation TypeEffect on c-di-AMPBacterial PhenotypeResearch Significance
Loss-of-functionSevere reductionGrowth inhibition/lethalityDemonstrates essentiality
Gain-of-functionIncreased levelsImpaired growthReveals toxicity of excess c-di-AMP
Binding interfaceAltered regulationVariable depending on interaction affectedIdentifies regulatory mechanisms
Catalytic siteReduced activityCompromised cell wall integrityMaps functional domains
  • Experimental approaches to study mutations:

    • Site-directed mutagenesis to create specific variants

    • Complementation assays in ybbP-depleted strains

    • Quantitative measurement of c-di-AMP levels using HPLC-MS/MS

    • Transcriptomic and proteomic analysis to assess global effects

  • Phenotypic characterization:

    • Growth curves under various conditions

    • Cell morphology analysis using phase-contrast and electron microscopy

    • Antibiotic susceptibility profiling, particularly to cell wall-targeting antibiotics

    • Sporulation efficiency measurement

  • Systems biology integration:

    • Combine transcriptomic and proteomic data to understand downstream effects

    • Apply hierarchical clustering of transcriptional data to identify co-regulated genes

    • Use network component analysis to model regulatory interactions

The study of ybbP/CdaA mutations provides valuable insights into bacterial signaling mechanisms and potential targets for antimicrobial development.

What approaches can resolve contradictory data regarding ybbP/CdaA function across different experimental systems?

Resolving contradictory data requires systematic investigation:

  • Common sources of contradictions in ybbP/CdaA research:

    • Strain differences (e.g., PY79 vs. strain 168 derivatives)

    • Expression system variations (heterologous vs. native expression)

    • Differences in growth conditions and media compositions

    • Membrane protein purification methods affecting protein conformation

    • Variable c-di-AMP detection methodologies

  • Reconciliation strategies:

    • Standardized protocols: Develop consensus procedures for ybbP/CdaA expression, purification, and activity measurement

    • Multiple strain validation: Test hypotheses across several B. subtilis strains to identify strain-specific effects

    • Complementary techniques: Apply orthogonal methods to verify findings (e.g., genetic and biochemical approaches)

    • In vivo and in vitro comparison: Validate in vitro observations with in vivo functional assays

    • Quantitative benchmarking: Establish reference standards for c-di-AMP levels and ybbP activity

  • Advanced approaches for complex questions:

    • Single-cell analysis: Investigate cell-to-cell variation in ybbP/CdaA function

    • Time-resolved studies: Track temporal dynamics of c-di-AMP signaling

    • Structural biology integration: Combine functional data with structural information

    • Systems-level modeling: Develop mathematical models incorporating conflicting datasets to identify missing variables

  • Collaboration frameworks:

    • Establish community standards for reporting experimental conditions

    • Develop shared resources for strain and plasmid distribution

    • Create open databases for ybbP/CdaA functional data

By systematically addressing these areas, researchers can resolve apparent contradictions and develop a more complete understanding of ybbP/CdaA function.

How can researchers leverage new technologies to elucidate the complete signaling network involving ybbP/CdaA?

Cutting-edge technologies offer new possibilities for mapping the ybbP/CdaA signaling network:

  • Cryo-electron tomography approaches:

    • Cryo-FIB-ET (cryo-focused ion beam electron tomography) allows visualization of cellular structures at molecular resolution in their native state

    • This technique has already revealed unprecedented details about B. subtilis sporulation processes

    • Application to ybbP/CdaA could visualize its membrane localization and interactions with cell wall components

  • Chemical biology tools:

    • Reverse-polarity activity-based protein profiling (RP-ABPP) can capture electrophilic modifications on proteins

    • This approach could identify novel interaction partners or regulatory modifications of ybbP/CdaA

    • Photoactivatable crosslinkers could map transient interactions in the signaling network

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to construct comprehensive signaling networks

    • Apply network component analysis and model selection to simultaneously estimate transcription factor activities and learn expanded regulatory networks

    • Leverage hierarchical clustering of transcriptional data to identify genes co-regulated with ybbP/CdaA

  • Synthetic biology approaches:

    • Engineer minimal systems recapitulating ybbP/CdaA function

    • Create optogenetic or chemically inducible variants for temporal control of activity

    • Develop biosensors for real-time monitoring of c-di-AMP in living cells

  • Computational prediction methods:

    • Apply structure-based prediction of protein-protein interactions using Bayesian network classifiers

    • These approaches have shown surprising effectiveness by exploiting both close and remote geometric relationships between proteins

    • PrePPI and similar tools can generate new interaction hypotheses for experimental validation

By integrating these technologies, researchers can construct a comprehensive map of the c-di-AMP signaling network, potentially revealing new targets for antimicrobial development and deeper insights into bacterial physiology.

How can knowledge about ybbP/CdaA inform strategies for antimicrobial development?

As an essential protein involved in a unique bacterial signaling pathway, ybbP/CdaA presents compelling opportunities for antimicrobial development:

  • Target validation evidence:

    • c-di-AMP is essential for bacterial viability but absent in mammals

    • Both insufficient and excessive c-di-AMP levels are detrimental to bacteria

    • ybbP/CdaA is conserved across many pathogenic Gram-positive bacteria

  • Potential inhibition strategies:

    • Direct competitive inhibitors targeting the ATP binding site

    • Allosteric inhibitors disrupting protein conformation

    • Inhibitors of protein-protein interactions with regulatory partners (e.g., CdaR)

    • Compounds disrupting membrane localization

  • Screening methodologies:

    • High-throughput enzymatic assays measuring c-di-AMP production

    • Cell-based assays utilizing c-di-AMP biosensors

    • Structure-based virtual screening against the ybbP/CdaA active site

    • Fragment-based drug discovery approaches

  • Potential advantages as antimicrobial target:

    • Narrow spectrum targeting of specific bacterial groups

    • Novel mechanism of action distinct from existing antibiotics

    • Potential activity against biofilm formation

    • Possible synergy with cell wall-targeting antibiotics

  • Challenges to consider:

    • Membrane localization may complicate inhibitor access

    • Potential for resistance development through compensatory mutations

    • Need for species-specific inhibitors to avoid broad disruption of microbiome

Recent research has demonstrated that B. subtilis-derived lipopeptides can disrupt quorum sensing and biofilm formation in Staphylococcus aureus , suggesting that targeting signaling pathways can be an effective antimicrobial strategy.

What insight does ybbP/CdaA research provide for understanding bacterial adaptation and survival mechanisms?

Research on ybbP/CdaA illuminates fundamental aspects of bacterial physiology:

  • Signaling network integration:

    • c-di-AMP signaling networks interface with other bacterial signaling pathways

    • This creates a sophisticated regulatory system allowing fine-tuned responses to environmental changes

    • Understanding these networks provides insight into bacterial decision-making processes

  • Stress response mechanisms:

    • c-di-AMP levels modulate responses to various stressors

    • Changes in cell wall composition and integrity represent critical adaptation strategies

    • The essentiality of c-di-AMP signaling highlights its central role in stress survival

  • Developmental transitions:

    • Different diadenylate cyclases (CdaA/ybbP, CdaS, DisA) become active during different developmental stages

    • This specialization allows for context-specific signaling during growth, sporulation, and DNA damage responses

    • The coordination between these cyclases reveals principles of bacterial developmental regulation

  • Evolutionary considerations:

    • The conservation of c-di-AMP signaling across diverse bacterial species suggests ancient evolutionary origins

    • Variations in the c-di-AMP network between species illuminate adaptation to different ecological niches

    • Comparing ybbP/CdaA across species can reveal selective pressures driving bacterial evolution

  • Biotechnological applications:

    • Understanding c-di-AMP signaling facilitates the engineering of B. subtilis as a cell factory

    • Knowledge of these pathways enables optimization of protein secretion and value-added chemical production

    • Engineered control of c-di-AMP signaling could enhance spore-based display technologies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.