Recombinant Bacillus subtilis Uncharacterized protein ybcM (ybcM)

Shipped with Ice Packs
In Stock

Description

Introduction to ybcM

The Recombinant Bacillus subtilis Uncharacterized Protein ybcM (ybcM) is a recombinant protein produced through heterologous expression in Escherichia coli systems. Classified under the KEGG identifier BSU01900 and STRING identifier 224308.Bsubs1_010100001073, ybcM is annotated as an uncharacterized protein, indicating that its precise biological function, cellular role, or biochemical activity remains undefined in scientific literature .

Production and Expression

ybcM is synthesized via recombinant DNA technology, where its coding sequence is cloned into plasmid vectors for expression in E. coli. This approach aligns with established protocols for producing B. subtilis-derived proteins, which often leverage E. coli for scalability and cost efficiency . Key considerations include:

  • Expression Optimization: No specific induction parameters or promoter systems are reported for ybcM.

  • Post-Production Processing: Purification methods likely involve chromatography or affinity tags, though details remain proprietary .

Research and Functional Insights

  • Uncharacterized Proteins in B. subtilis: Many B. subtilis proteins lack functional annotations due to limited experimental validation. For example, proteins like ypbE (Uniprot P50731) remain poorly studied, mirroring ybcM’s classification .

  • Recombinant Protein Systems: B. subtilis is widely used for heterologous protein production due to its GRAS (Generally Recognized as Safe) status and robust secretion machinery. Studies highlight its utility in expressing bioactive molecules, though secretion bottlenecks persist .

Potential Applications and Future Directions

While ybcM’s direct applications are unexplored, its recombinant production in E. coli suggests potential utility in:

  • Structural Biology: X-ray crystallography or NMR studies to determine tertiary structure.

  • Functional Screens: High-throughput assays to identify enzymatic or binding activities.

  • Biotechnological Platforms: Integration into B. subtilis systems for biofilm engineering or protein immobilization, as demonstrated with sortase-mediated surface display .

Table 1: Comparative Overview of B. subtilis Recombinant Proteins

ProteinUniprot IDExpression HostKey FeaturesReference
ybcMN/AE. coliUncharacterized; high-purity formulations
ypbEP50731E. coliFull-length sequence available; storage at -20°C
YITBO06737E. coli236 amino acids; Tris-based buffer

Table 2: General B. subtilis Recombinant Protein Production Strategies

StrategyAdvantagesLimitationsExamples
Plasmid-based expressionScalable; inducible promotersMetabolic burden on host cellspHT43 vector (RFP-COE fusion)
Chromosomal integrationStable expression; no plasmid lossLower yield compared to plasmid systemsSortase srtD for surface display
Secretion systemsDirect protein export; reduced intracellular toxicitySignal peptide compatibility requiredAmyQ-FnBPB fusion

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please indicate any specific format requirements when placing your order, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please contact your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a preferred tag type, please let us know, and we will prioritize developing it for your product.
Synonyms
ybcM; BSU01900; Uncharacterized protein YbcM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ybcM
Target Protein Sequence
MRFLKALPRRAEVQYDCLDRTLETQENVNLNIRVNVKEVATWGVNTCIISLKGLDNADDR FVLPEVNTALALFPLSIAADCLLMLPCISVVMSISSVMKSVTVE
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What initial experimental approaches are recommended for characterizing the biochemical activity of YbcM?

To determine YbcM’s biochemical function, researchers should prioritize in vitro reconstitution assays using recombinant protein purified from heterologous expression systems (e.g., Escherichia coli BL21). Key steps include:

  • Recombinant Expression: Clone the ybcM gene into a plasmid with an affinity tag (e.g., His-tag) for purification. Optimize induction conditions to enhance soluble protein yield, as demonstrated for B. subtilis YvcI and YhaM .

  • Substrate Screening: Test enzymatic activity against potential substrates (RNA, DNA, nucleotides) under varying pH, temperature, and cofactor conditions. For example, YvcI’s RNA pyrophosphohydrolase activity was identified using 5′-triphosphorylated RNA substrates in Mn²⁺-dependent reactions .

  • Kinetic Assays: Quantify reaction rates using spectrophotometric or radiolabeled substrates. Activity assays for B. subtilis YhaM revealed Mn²⁺-dependent 3′-to-5′ exoribonuclease activity, which was absent in Mg²⁺ .

Key Consideration: Include negative controls (e.g., catalytically inactive YbcM mutants) to distinguish specific activity from background noise.

How can bioinformatics tools predict YbcM’s functional role and evolutionary conservation?

Comparative genomics and structural modeling are critical for generating hypotheses about YbcM’s function:

  • Sequence Homology Analysis: Use BLASTP to identify orthologs in related species. For instance, B. subtilis YhaM homologs are restricted to gram-positive bacteria, suggesting niche-specific roles .

  • Domain Architecture: Tools like InterPro or Pfam can identify conserved domains. YhaM’s C-terminal HD domain (metal-dependent phosphohydrolase) and N-terminal OB-fold (nucleotide binding) were linked to its exonuclease activity through structural modeling .

  • Phylogenetic Profiling: Correlate YbcM’s presence/absence across species with metabolic pathways or stress responses.

Example Workflow:

  • Identify conserved residues in YbcM’s putative catalytic motifs.

  • Model tertiary structure using AlphaFold2 or SWISS-MODEL.

  • Compare with structurally characterized proteins (e.g., YjcG, a putative RNA ligase) .

What strategies resolve contradictions in YbcM’s proposed regulatory roles?

Conflicting data about YbcM’s involvement in transcriptional networks require multi-omics integration:

  • Chromatin Immunoprecipitation (ChIP-exo): Map YbcM-DNA interactions genome-wide. In E. coli, ChIP-exo identified binding sites for uncharacterized TFs like YciT and YdhB .

  • RNA Sequencing: Compare transcriptomes of wild-type and ΔybcM strains under stress conditions (e.g., sporulation, nutrient limitation).

  • Genetic Interaction Networks: Perform synthetic lethality screens with ybcM deletion and mutations in known regulatory genes.

Case Study: The B. subtilis transcriptional network model predicted 2,258 novel regulatory interactions, validated through targeted mutagenesis and phenotyping . Apply similar combinatorial approaches to confirm YbcM’s regulatory targets.

How can researchers validate YbcM’s interaction partners in vivo?

Methodology:

  • Bacterial Two-Hybrid (BTH) Assays: Screen for interactions with RNA polymerase subunits, transcription factors, or ribonucleases.

  • Co-Immunoprecipitation (Co-IP): Use anti-YbcM antibodies to pull down complexes from B. subtilis lysates.

  • Fluorescence Microscopy: Tag YbcM with GFP and monitor co-localization with cellular structures (e.g., nucleoid, cell membrane).

Example: B. subtilis YfnH-YFP and SpsM-CFP co-localized during sporulation, revealed through dual-labeling fluorescence microscopy .

What experimental designs address low expression or insolubility of recombinant YbcM?

Optimization Strategies:

VariableApproachExample
Expression HostUse B. subtilis expression systems (e.g., strain PY79) for native folding. Recombinant antigens in B. subtilis spores achieved higher solubility than E. coli .
Induction ConditionsTest lower temperatures (16–25°C) and staggered IPTG concentrations. YvcI required Mn²⁺ for stability during purification .
Fusion TagsEmploy solubility-enhancing tags (e.g., MBP, SUMO). YjcG was crystallized after expression in E. coli BL21 with a His-tag .

Troubleshooting Tip: Conduct small-scale expression trials with 10–20 variables (e.g., lysis buffers, protease inhibitors) to identify optimal conditions.

How does YbcM’s role intersect with sporulation and stress adaptation in B. subtilis?

Advanced studies should leverage B. subtilis’s genetic tractability to probe YbcM’s contribution to stress responses:

  • Phenotypic Profiling: Compare ΔybcM and wild-type strains under oxidative stress, UV radiation, or nutrient deprivation. Laboratory evolution experiments revealed adaptive mutations in sporulation genes under stringent selection .

  • Transcriptional Profiling: Integrate RNA-seq data from ΔybcM strains with existing B. subtilis transcriptional compendia (e.g., 403 samples across 38 conditions) .

  • Epistatic Analysis: Overexpress ybcM in mutants lacking known stress-response regulators (e.g., σ factors).

Hypothesis Testing: If YbcM regulates sporulation, ΔybcM strains will exhibit delayed spore formation under starvation.

What computational tools prioritize YbcM’s putative functional annotations?

Advanced Workflow:

  • Network Component Analysis (NCA): Predict YbcM’s position in transcriptional networks using gene co-expression data .

  • Machine Learning: Train classifiers on features like codon adaptation index, operon structure, and evolutionary conservation.

  • Functional Enrichment: Use hypergeometric tests to identify overrepresented COG categories among YbcM-regulated genes, as done for E. coli YciT and YdhB .

Validation: Cross-reference predictions with in vitro DNA-binding assays (e.g., EMSA) and in vivo reporter fusions.

How can structural studies overcome crystallization challenges with YbcM?

Crystallization Pipeline:

  • Mutagenesis: Engineer surface-entropy reduction variants by replacing flexible loops with alanine residues.

  • Crystallization Screens: Use sparse-matrix screens (e.g., Hampton Research) with varying PEG concentrations and pH. YjcG crystallized in space group C2 (a = 99.66 Å, b = 73.93 Å, c = 61.77 Å) using 25% PEG 3350 .

  • Cryo-EM Backup: If crystals diffract poorly (<3 Å), switch to single-particle cryo-EM for structure determination.

Key Insight: Metal cofactors (e.g., Mn²⁺, Co²⁺) often stabilize proteins like YhaM during crystallization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.