Recombinant Bacillus subtilis Uncharacterized protein ybdG (ybdG)

Shipped with Ice Packs
In Stock

Description

Characteristics of Bacillus subtilis

Bacillus subtilis is a Gram-positive bacterium commonly found in soil and the gastrointestinal tract of ruminants and humans . It is rod-shaped and has the ability to form a protective endospore, allowing it to tolerate harsh environmental conditions . Bacillus subtilis is widely used in industrial biotechnology for the production of various enzymes, antibiotics, and other valuable compounds .

Recombinant Production

Recombinant protein production in Bacillus subtilis offers several advantages, including:

  • Secretion Capability: Bacillus subtilis can secrete proteins directly into the culture medium, simplifying purification processes .

  • Non-Pathogenic Nature: Bacillus subtilis is generally recognized as safe (GRAS), making it a suitable host for producing proteins for pharmaceutical and food applications .

  • Well-Developed Genetic Tools: A range of genetic tools are available for manipulating the Bacillus subtilis genome, facilitating efficient recombinant protein production .

  • Natural competence: Bacillus subtilis demonstrates natural competence combined with its efficient homologous recombination machinery, allowing fast, straightforward, and stable integration of large BGCs in the genome .

Potential Applications

Although the specific function of ybdG is unknown, recombinant ybdG may have potential applications in various fields:

  • Structural Biology: Recombinant ybdG can be produced for structural studies to determine its three-dimensional structure, which may provide insights into its function.

  • Drug Discovery: ybdG may be a potential target for drug development, and recombinant ybdG could be used in screening assays to identify inhibitors of its activity.

  • Biotechnology: ybdG may possess enzymatic activity that could be exploited in biotechnological applications.

Research Findings

Genome engineering has revealed large dispensable regions in Bacillus subtilis . Deletion of prophage 1 (202092–220145 bp SubtiList coordinates) was achieved using primer pairs GlmS1/GlmS2 and YbdG1/YbdG2 and ligated into pORI280 after PCR-mediated splicing by overlap extension . The resulting plasmid, p280GY, was used to transform B. subtilis for chromosomal integration into glmS or ybdG .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ybdG; ybdH; BSU01990; Uncharacterized protein YbdG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ybdG
Target Protein Sequence
MKTLWKVLKIVFVSLAALVLLVSVSVFIYHHFQLNKEAALLKGKGTVVDVDGKKMNVYQE GSGKDTFVFMSGSGIAAPAYEMKGLYSKFSKENKIAVVDRAGYGYSEVSHDDRDIDTVLE QTRKALMKSGNKPPYILMPHSISGIEAMYWAQKYPKEIKAIIAMDIGLPQQYVTYKLSGV DRLKVRGFHLLTSIGFHRFIPSAVYNPEVIRQSFLTDEEKEIYKAINFKQFFNADMEHEL LQSYQNGSKSVNLPAPKETPVLILDAVSDQNRHSKYAIQNRKDYEAFAAQFNTADIKELR GTHSIYLYQPDQIYKLSMEFMRKVR
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is currently known about the function of ybdG in Bacillus subtilis?

While ybdG in Bacillus subtilis remains largely uncharacterized, studies in Escherichia coli have demonstrated that YbdG functions as a threshold-setting mechanosensitive channel. In E. coli, YbdG differs from the well-characterized MscS (mechanosensitive channel of small conductance) in several key structural aspects. YbdG possesses a larger membrane domain with five transmembrane spans compared to MscS, with the fifth transmembrane helix showing the closest sequence similarity to the MscS pore-lining helix . Additionally, YbdG contains a unique ~50-amino-acid insertion in its carboxyl-terminal cytoplasmic domain that is conserved among YbdG homologs but not widely present in other proteins .

The function of ybdG in B. subtilis would likely need to be investigated through knockout studies, electrophysiological measurements, and stress response assays to determine if it plays a similar role in mechanosensation or osmotic regulation as observed in E. coli.

How do the structural features of ybdG compare to other characterized membrane proteins in Bacillus subtilis?

While direct structural data for B. subtilis ybdG is not provided in the search results, insights can be drawn from the E. coli homolog. The E. coli YbdG protein contains five transmembrane spans with the fifth transmembrane helix bearing closest sequence similarity to the pore-lining helix of MscS . The protein also contains a distinctive carboxyl-terminal cytoplasmic domain with an approximately 50-amino-acid insertion near the junction between the upper β and the αβ domains .

Compared to other B. subtilis membrane proteins like YngB (a UTP-glucose-1-phosphate uridylyltransferase that contributes to wall teichoic acid glucosylation), ybdG would likely be characterized by different structural motifs reflective of its potential mechanosensitive channel function rather than enzymatic activity .

What expression patterns of ybdG have been observed under different growth conditions?

Studies of YbdG expression in E. coli have revealed condition-dependent regulation. Quantitative real-time PCR (qRT-PCR) analyses showed that ybdG mRNA levels increase as cells enter stationary phase . Additionally, high osmolarity stimulates ybdG mRNA synthesis, though interestingly, elimination of the stress-response regulator RpoS increased ybdG mRNA abundance rather than decreasing it, contrasting with the regulation pattern of other mechanosensitive channels .

There is also evidence of translational control affecting YbdG protein expression. In E. coli cells grown at low osmolarity, there was no significant correlation between mRNA production and YbdG protein levels, suggesting post-transcriptional regulation . In contrast, during growth in the presence of 0.5 M NaCl, protein expression matched the pattern of mRNA production, confirming the role of high osmolarity in YbdG abundance .

What are the optimal expression systems for recombinant B. subtilis ybdG production?

For recombinant production of B. subtilis membrane proteins like ybdG, E. coli or yeast expression systems are commonly employed. According to available product specifications for similar recombinant B. subtilis proteins, E. coli or yeast sources are typically used for heterologous expression . The specific choice depends on several factors:

How can the purity and yield of recombinant ybdG be optimized?

Optimizing purity and yield of recombinant membrane proteins like ybdG requires careful consideration of several factors:

  • Purification tags: His-tagging is a common approach for purification of recombinant proteins, allowing for affinity chromatography purification . For B. subtilis membrane proteins, C-terminal or N-terminal His-tags can be employed depending on predicted topology.

  • Membrane extraction: Efficient solubilization using appropriate detergents is critical for membrane protein purification. The choice of detergent must maintain protein stability and activity.

  • Storage conditions: For long-term stability, storage at -20°C to -80°C is recommended, while short-term storage at +4°C may be suitable . PBS buffer is commonly used as a storage buffer for recombinant proteins .

  • Expression optimization: To maximize yield while minimizing toxicity, researchers should test various induction conditions (IPTG concentration, temperature, induction time). Lower temperatures (16-25°C) often improve membrane protein folding and reduce toxicity.

The expected purity should be >80% as assessed by SDS-PAGE, with endotoxin levels below 1.0 EU per μg of protein . Custom production of such proteins typically requires 5-9 weeks of lead time due to optimization requirements .

What challenges are specific to the expression of recombinant membrane proteins like ybdG?

Expression of membrane proteins presents unique challenges:

  • Growth inhibition: Recombinant protein production, especially of membrane proteins, can significantly inhibit host cell growth. Interestingly, research has shown that even transcription of the recombinant gene without translation (by removing the ribosome binding site) can cause growth inhibition . This suggests that the metabolic burden of high-level transcription alone can stress cells.

  • Toxicity mechanisms: When comparing cells carrying plasmids with and without ribosome binding sites, those with intact translation showed more severe growth inhibition, indicating that both transcription and translation of membrane proteins contribute to toxicity . In defined media, these effects are often more pronounced than in complex media .

  • Protein folding issues: Membrane proteins require proper insertion into membranes for correct folding. Overexpression can overwhelm the membrane protein insertion machinery, leading to aggregation and inclusion body formation.

  • Expression level verification: Methods like SDS-PAGE are essential to verify expression levels. In some experimental systems, expression levels of recombinant transcripts have been shown to reach more than 2000 times higher levels than housekeeping genes like tufA .

What electrophysiological techniques are most effective for characterizing ybdG channel activity?

Based on studies of YbdG in E. coli, the following electrophysiological approaches would be valuable for characterizing B. subtilis ybdG:

  • Patch clamp technique: This has been effectively used to characterize mechanosensitive channel activity in bacterial systems. For YbdG in E. coli, patch clamp analyses were performed on giant protoplasts derived from cephalexin-treated cells . This technique can detect channel openings and measure conductance.

  • Conductance measurement: E. coli YbdG exhibits channel activity with conductance of 350-400 pS, similar to what has been described as MscM (mechanosensitive channel of mini conductance) . Researchers should look for similar conductance ranges when characterizing B. subtilis ybdG.

  • Pressure threshold determination: For mechanosensitive channels, determining the pressure threshold for gating is critical. Researchers should compare the gating threshold of ybdG to other characterized mechanosensitive channels like MscL, which can serve as a reference .

  • Mutant analysis: Introducing specific mutations can provide insights into channel function. For example, in E. coli YbdG, a V229A mutation led to increased frequency of channel openings without affecting conductance, suggesting altered gating properties .

When setting up these experiments, it's important to create giant protoplasts, establish proper electrode connections, and carefully control environmental factors like temperature and buffer composition.

How can researchers differentiate between native and recombinant ybdG expression in functional studies?

To distinguish between native and recombinant ybdG in functional studies, researchers can implement several strategies:

  • Genetic manipulation: Creating knockout strains (ΔybdG) provides a clean background for introducing recombinant ybdG. Studies of E. coli YbdG compared strain MJF429 (YbdG+) with strain MJF611 (ΔybdG) to assess channel activity .

  • Controlled expression systems: Using inducible promoters like the IPTG-inducible T7 system allows temporal control of recombinant expression. Researchers used this approach to express both wild-type and mutant YbdG for functional studies .

  • Protein tagging: His-tags can be added to recombinant ybdG to distinguish it from native protein . These tags allow not only for purification but also for detection via western blotting with anti-His antibodies.

  • Competition studies: Interestingly, expression of a mutant YbdG (V229A) showed increased channel activity in a ΔybdG background but not in a wild-type background, suggesting competition for resources or formation of heteromeric channels . Similar approaches could be used to study B. subtilis ybdG.

  • Quantitative expression analysis: Using qRT-PCR to measure transcript levels and western blotting to measure protein levels can help quantify recombinant expression relative to native expression under different conditions .

What approaches can determine if ybdG interacts with cell wall components in B. subtilis?

To investigate potential interactions between ybdG and cell wall components in B. subtilis, researchers could employ several approaches:

  • Co-localization studies: Fluorescently tagged ybdG can be visualized along with labeled cell wall components to determine spatial relationships.

  • Protein-protein interaction assays: Techniques like bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking studies could identify interactions between ybdG and cell wall synthesis machinery.

  • Cell wall analysis in mutants: Analysis of cell wall composition in ybdG knockout or overexpression strains might reveal alterations in cell wall structure. For example, in studies of B. subtilis YngB (a UTP-glucose-1-phosphate uridylyltransferase), researchers used concanavalin A, a lectin that specifically binds to terminal glucose residues, to assess wall teichoic acid (WTA) glucosylation . Similar approaches could be used to investigate if ybdG affects cell wall properties.

  • Phenotypic analysis: Examination of cell morphology and osmotic sensitivity in ybdG mutants could reveal connections to cell wall function. Mutants with altered cell wall proteins often display morphological defects, as observed with gtaB mutants which showed curled cells with bulges .

  • Growth under varying conditions: Testing growth under conditions that challenge cell wall integrity (osmotic stress, antibiotics targeting cell wall) in wild-type versus ybdG mutant strains could reveal functional relationships.

How does oxygen availability affect ybdG expression compared to other membrane proteins?

While specific information about B. subtilis ybdG expression under varying oxygen conditions is not provided in the search results, insights can be drawn from studies of other B. subtilis proteins and E. coli ybdG:

  • Growth-phase dependent regulation: In E. coli, ybdG mRNA levels increase as cells enter stationary phase, suggesting regulation related to metabolic state changes that might be connected to oxygen availability .

  • Comparison with oxygen-responsive genes: In B. subtilis, the YngB protein (a UTP-glucose-1-phosphate uridylyltransferase) shows interesting oxygen-dependent expression patterns. YngB-dependent glycosylation of wall teichoic acid and glycolipid production was observed specifically when B. subtilis was grown under anaerobic fermentative conditions . This indicates that oxygen availability can significantly alter expression patterns of certain B. subtilis proteins.

  • Transcriptional regulation: The expression of YngB from its native promoter occurs under anaerobic conditions, revealing oxygen-dependent transcriptional regulation . Researchers investigating ybdG should examine if similar oxygen-responsive transcription factors might control its expression.

  • Functional implications: If ybdG expression is oxygen-dependent, this could suggest roles in adapting to varying oxygen environments, potentially through sensing membrane tension or facilitating adaptation to changing osmotic conditions that accompany shifts between aerobic and anaerobic metabolism.

To systematically investigate oxygen effects on ybdG expression, researchers should compare mRNA and protein levels under aerobic, microaerobic, and anaerobic conditions, and examine the effects of known oxygen-responsive transcription factors.

What mutagenesis strategies can help identify key functional residues in ybdG?

To identify key functional residues in ybdG, researchers can employ several mutagenesis approaches:

  • Site-directed mutagenesis of conserved residues: Targeting conserved amino acids, particularly those in predicted transmembrane regions. In E. coli YbdG, a V229A mutation was created that affected channel gating frequency without changing conductance . This approach can help identify residues involved in specific aspects of channel function.

  • Alanine-scanning mutagenesis: Systematically replacing residues in potential functional regions with alanine to identify those critical for activity.

  • Chimeric protein construction: Creating chimeric proteins between ybdG and well-characterized mechanosensitive channels can help identify functional domains. This approach takes advantage of the structural differences between YbdG and other mechanosensitive channels, such as the unique ~50-amino-acid insertion in the carboxyl-terminal cytoplasmic domain of YbdG .

  • Random mutagenesis and functional screening: Using error-prone PCR to generate a library of random mutants, followed by screening for altered channel properties, can identify unexpected functionally important residues.

  • Conservative and non-conservative substitutions: For key residues, testing both conservative (similar physicochemical properties) and non-conservative substitutions can provide insights into the specific requirements at that position.

The effects of mutations can be assessed using patch clamp to measure channel activity , growth assays under osmotic stress conditions, and protein localization studies to ensure proper membrane integration.

What quality control methods ensure proper folding and membrane integration of recombinant ybdG?

Ensuring proper folding and membrane integration of recombinant ybdG requires several quality control approaches:

  • Functional activity assays: For mechanosensitive channels like ybdG, patch clamp electrophysiology provides the most direct evidence of proper folding and function . Properly folded channels should exhibit characteristic conductance (350-400 pS for E. coli YbdG) and gating properties.

  • Membrane fraction analysis: Proper subcellular fractionation followed by western blotting can confirm localization of ybdG to the membrane fraction. Studies of E. coli YbdG verified protein presence in membrane samples derived from cephalexin-treated cells .

  • Protein quantification: SDS-PAGE analysis with appropriate standards can verify expression levels and assess purity, which should be >80% for properly purified protein .

  • Detergent solubility profiling: Testing solubilization in different detergents can provide insights into membrane integration status.

  • Protease accessibility assays: Limited proteolysis of membrane preparations can distinguish between properly integrated versus misfolded protein based on differential protease accessibility patterns.

  • Circular dichroism spectroscopy: This technique can provide information about secondary structure content to confirm proper folding.

  • Size exclusion chromatography: This can assess oligomeric state and homogeneity, important for channel proteins that typically function as multimers.

How can researchers address growth inhibition during recombinant ybdG expression?

To mitigate growth inhibition during recombinant ybdG expression, researchers can implement several strategies:

  • Optimize induction conditions: Studies have shown that recombinant protein production causes growth inhibition, with the severity depending on induction conditions . Researchers should test different IPTG concentrations and induction timing to find optimal conditions.

  • Use tightly controlled expression systems: Since even transcription without translation causes growth inhibition , using expression systems with minimal leaky expression is important.

  • Growth media optimization: The severity of growth inhibition varies between complex media (like LB) and defined media . Testing different media formulations may identify conditions that better support growth during expression.

  • Lower growth temperature: Reducing temperature during induction (to 16-25°C) often reduces toxicity while still allowing protein expression.

  • Codon optimization: Adjusting the coding sequence to match host codon usage can reduce ribosomal pausing and associated stress.

  • Co-expression of chaperones: Expressing molecular chaperones alongside ybdG may improve folding and reduce toxicity.

  • Use specialized expression strains: Some E. coli strains are designed to better tolerate membrane protein expression.

  • Implement fed-batch strategies: Controlling nutrient availability through fed-batch approaches can help balance growth and expression.

The key is to find conditions that allow sufficient protein expression while minimizing cellular stress, recognizing that both transcription and translation of recombinant genes contribute to growth inhibition .

What experimental controls are essential when characterizing recombinant ybdG function?

When characterizing recombinant ybdG function, several key controls are essential:

  • Empty vector control: Cells transformed with the expression vector lacking the ybdG gene help distinguish effects of the expression system from effects of the protein itself.

  • Inactive mutant control: A non-functional ybdG mutant (e.g., pore-blocking mutation) expressed under identical conditions helps confirm that observed effects are due to ybdG activity rather than merely its presence.

  • Knockout strain comparison: Comparing wild-type strains with ybdG knockout strains helps establish the baseline phenotype in the absence of the protein. Studies of E. coli YbdG compared strain MJF429 (YbdG+) with strain MJF611 (ΔybdG) to assess channel activity .

  • Reference channel controls: When performing electrophysiological studies, well-characterized mechanosensitive channels like MscL can serve as references for the presence of channel activity, as demonstrated in E. coli YbdG studies .

  • Expression level verification: Confirmation of protein expression using SDS-PAGE and/or western blotting is essential, as performed in studies of both E. coli YbdG and other recombinant proteins .

  • Complementation controls: Testing whether expression of recombinant ybdG can complement phenotypes of ybdG knockout strains confirms functional equivalence.

  • Conditional expression controls: Comparing induced versus uninduced samples helps establish the relationship between expression level and observed effects.

These controls help ensure that observed phenomena are specifically attributable to recombinant ybdG function rather than experimental artifacts or secondary effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.