Recombinant Bacillus subtilis Uncharacterized protein ybfF (ybfF)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of YbfF

Gene and Protein Details:

  • Gene Name: ybfF (Ordered Locus: BSU02190) .

  • UniProt ID: O31446 .

  • Protein Length: 303 amino acids (full-length) .

  • Sequence Features: Includes a hydrophobic transmembrane domain, suggesting potential membrane association .

  • Isoelectric Point (pI): Predicted to be basic, though exact value unconfirmed .

Expression System:

  • Produced in Escherichia coli via in vitro expression, tagged with an N-terminal 10×His-tag for purification .

Role in B. subtilis:

  • Non-essential: Deletion of ybfF (alone or with paralog ymxC) does not impair viability under standard conditions .

  • Localization: Predominantly ribosome-associated (50S subunit), with phase-dependent expression .

Comparative Host Systems:
B. subtilis is a preferred host for recombinant protein production due to:

  • GRAS/QPS Status: Recognized as safe for industrial and biomedical applications .

  • Secretion Efficiency: Superior secretory pathways reduce downstream processing costs .

FeatureB. subtilisE. coli
Endotoxin ProductionNoneHigh
Secretion CapacityHigh (extracellular)Limited (intracellular)
Regulatory ApprovalSimplified (GRAS/QPS)Complex
Recombinant YieldModerate to HighHigh

Research Applications and Knowledge Gaps

Current Use Cases:

  • Antigen Production: Commercial availability supports immunological studies (e.g., ELISA) .

  • Structural Biology: Homology models guide mutagenesis studies to elucidate binding motifs .

Unresolved Questions:

  • Function: No enzymatic or metabolic role confirmed; speculated to interact with ribosomal subunits .

  • Engineering Potential: Lack of functional data hinders targeted modification for industrial applications.

Future Directions

  • CRISPR-Cas9 Editing: Could clarify ybfF’s role via knockout/knock-in studies in B. subtilis .

  • Proteomic Profiling: Comparative analyses under stress conditions may reveal transient interactions .

  • Heterologous Expression: Leveraging B. subtilis’ secretion machinery for scaled YbfF production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your preferred format when placing your order, and we will fulfill your requirements to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery information, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point for your own protocols.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate this to us, and we will prioritize development of the specified tag.
Synonyms
ybfF; BSU02190; Uncharacterized protein YbfF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ybfF
Target Protein Sequence
MKNDQIVFEKTKNIAHDINQMQNQQEIIDYLFRQDSLTLNQLKHYYSEPSLPLQFLVKVA VLCMFISMTLASFLFIQAKEVFTNTILSDISPAVFSIFTVICIFMTYTKIIKKGNKNKGK ASLNQRSEFYEKNKLINTILYKKYKMDQQNIQANKHTASDNEDSMNFSAVLNHVLTISKN DKELLGYLDTRDNAMLSQLKAYFSTRPFSLPHYMSLMFCGSIIVVYATSLFSGQINYIDI PHIFIFLLLIIFLKILIDLIKLLNISRKGQLHTVLHFAQRAEYLRMRGVIDFILTERYNK KIM
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis and why is it significant for protein research?

Bacillus subtilis is one of the most studied and best understood bacterial organisms alongside Escherichia coli, serving as a model for many important pathogens. Its significance stems from several key characteristics:

  • It forms heat-resistant spores that can germinate even after extended periods, making it a subject of significant scientific interest

  • It exhibits genetic competence, a developmental state in which it actively takes up exogenous DNA, making it highly amenable to genetic manipulation and investigation

  • It was among the first organisms to have its genome fully sequenced, enabling extensive genome-wide and proteome-wide studies

  • It serves as a model organism for other Firmicutes, including important Gram-positive pathogens such as Bacillus anthracis, Staphylococcus aureus, and Listeria monocytogenes

  • Its versatile metabolism and non-pathogenic nature make it suitable for various research applications and biotechnological uses

Ferdinand Julius Cohn renamed this bacterium from Vibrio subtilis to Bacillus subtilis (the "subtle rod") in 1872 and discovered its ability to form heat-resistant spores, which eventually led to the development of pasteurization techniques .

How do researchers approach the study of uncharacterized proteins in B. subtilis?

Studying uncharacterized proteins like ybfF typically follows a systematic approach:

  • Genomic context analysis: Examining the gene's location and neighboring genes for functional clues. For instance, related proteins like YbxF are part of the streptomycin operon in gram-positive bacteria, providing initial functional insights

  • Sequence homology studies: Comparing the protein sequence with characterized proteins in databases to identify potential functions based on evolutionary relationships

  • Structural prediction and modeling: Using computational tools to predict protein structure, as demonstrated with YbxF where homology modeling generated three-dimensional structures that helped identify functional regions

  • Localization studies: Determining where the protein resides within the cell, as with YbxF which was found to localize primarily to the 50S ribosomal subunit with growth phase dependence

  • Deletion/mutation analysis: Creating gene knockouts or targeted mutations to observe phenotypic effects, similar to studies with YbxF and YmxC where researchers probed deletion strains in various functional assays

  • Interaction studies: Identifying protein-protein interactions to elucidate potential functions within cellular pathways

What techniques are commonly used to express recombinant B. subtilis proteins?

For successful expression of recombinant B. subtilis proteins like ybfF, researchers typically employ:

Expression SystemAdvantagesLimitationsBest For
E. coli expressionHigh yields, rapid growth, well-established protocolsMay lack post-translational modifications found in B. subtilisInitial characterization, structural studies
Native B. subtilis expressionProper folding, authentic post-translational modificationsLower yields than E. coliFunctional studies requiring native conditions
Genome-reduced B. subtilis strainsSuperior for difficult proteins due to deletion of protease genesMore complex genetic manipulationProteins sensitive to proteolytic degradation
Cell-free systemsAvoids toxicity issues, rapid productionGenerally lower yields, more expensiveToxic proteins or rapid screening

The choice of genome-reduced B. subtilis strains is particularly important for difficult-to-express proteins, as these strains have demonstrated superior performance for the production of secreted proteins due to the deletion of all protease-encoding genes .

What databases and tools are available for B. subtilis protein research?

Researchers studying uncharacterized B. subtilis proteins have access to several dedicated resources:

  • SubtiWiki: An essential integrated database that combines all types of information about B. subtilis in an intuitive and interactive manner. It is unique in that it fully integrates all information and is completely free to use

  • Genome databases: Providing access to the complete genome sequence of B. subtilis, which has undergone several revisions since its initial publication in the 1990s

  • Proteomic resources: Repositories of experimental data on B. subtilis proteins that can aid in comparative analysis

  • Essential gene catalogs: Data on the set of essential genes in B. subtilis, identified through systematic studies and continuously refined

Using these resources, researchers can find information on gene context, conservation across species, expression patterns under different conditions, and potential functional relationships with other proteins.

How should researchers design experiments to characterize novel proteins like ybfF?

Effective experimental design for novel protein characterization requires careful planning:

  • Implement mini-experiment approaches: Instead of conducting a single large experiment under strictly standardized conditions, consider dividing the work into smaller "mini-experiments" with slight variations in laboratory conditions. This approach has been shown to improve reproducibility by better reflecting natural biological variation

  • Include appropriate controls: Design experiments with both positive and negative controls relevant to the predicted function of the uncharacterized protein

  • Consider growth-phase dependence: Since related proteins like YbxF show growth-phase dependent localization, experiments should examine the protein across different growth phases

  • Employ mutation analysis strategically: Based on structural predictions, target specific residues for mutation, similar to how researchers identified Lys24 in helix 2 as crucial for YbxF's interaction with ribosomes

  • Use complementary approaches: Combine genetic, biochemical, and structural approaches to build a comprehensive understanding of the protein's function

The mini-experiment design approach is particularly valuable as it has been demonstrated to yield more reproducible results compared to conventional standardized designs, addressing a significant challenge in experimental biology known as the "reproducibility crisis" .

What should researchers do when their data analysis results for ybfF contradict published findings?

When facing contradictory data analysis results:

  • Approach with curiosity and skepticism: View contradictions as opportunities for discovery rather than errors

  • Re-examine methodologies: Carefully review both your methods and those of the contradicting studies, looking for subtle differences in experimental conditions, strain backgrounds, or analytical approaches

  • Consider biological context: As demonstrated with sporulation studies in B. subtilis, seemingly contradictory findings may reflect the complexity of biological systems. For example, historically, researchers discovered that both a two-component system (phosphorelay) and alternative sigma factors were involved in sporulation regulation, initially appearing as competing rather than complementary explanations

  • Validate with independent techniques: Confirm your findings using alternative methodological approaches

  • Collaborative resolution: Engage with colleagues who obtained different results to jointly investigate the source of discrepancies

  • Check for strain-specific effects: Minor genetic differences between laboratory strains can lead to contradictory results

Understanding that data analysis is an iterative process helps in addressing contradictions constructively, potentially leading to new insights that benefit research progress .

How can researchers determine if ybfF is involved in ribosomal function?

Given that related proteins like YbxF localize to ribosomes, investigating ybfF's potential role in ribosomal function would involve:

  • Localization studies: Using fluorescence microscopy with tagged ybfF protein or immunofluorescence to determine if it co-localizes with ribosomes, similar to YbxF's demonstrated localization to the 50S ribosomal subunit

  • Ribosome profiling: Analyzing ribosome-associated mRNAs in wild-type versus ybfF deletion strains to identify translation differences

  • Polysome analysis: Examining whether ybfF deletion affects polysome profiles

  • Growth phase dependence: Testing if ybfF association with ribosomes varies with growth phase, as observed with YbxF

  • Mutational analysis of key residues: Based on structural predictions, create point mutations in domains predicted to interact with ribosomes, similar to how Lys24 in helix 2 was identified as crucial for YbxF-ribosome interaction

  • Translation assays: Measuring translation efficiency in the presence and absence of ybfF protein

TechniqueInformation ProvidedTechnical ComplexitySample Requirement
Co-sedimentation with ribosomesPhysical associationModerateLarge culture volumes
Cryo-EM structural analysisBinding site on ribosomeVery highPurified components
Ribosome profilingEffect on translationHighMid-scale cultures
In vitro translation assaysDirect functional impactModeratePurified components
Genetic suppressor screensGenetic interactionsModerateGenetic library

What considerations are important when designing knockout experiments for potentially essential genes?

When designing knockout experiments for proteins like ybfF:

  • Check for paralogs: Examine if the genome contains paralogs that might provide functional redundancy, as seen with YbxF and its paralog YmxC in B. subtilis

  • Construct conditional knockouts: Use inducible/repressible promoters to control gene expression if complete deletion is lethal

  • Create double knockout strains: If paralogs exist, generate single and double deletion strains to test for redundancy, as was done with ΔybxF, ΔymxC, and ΔybxF ΔymxC double deletion strains

  • Employ genome-wide approaches: Consider using the blueprint of minimal gene sets in B. subtilis, which comprises 523 protein-coding genes and 119 RNA-coding genes deemed essential

  • Consult essentiality databases: Reference the cataloged essential genes in B. subtilis, which have undergone several revisions

  • Monitor growth under various conditions: Test knockout strains under different environmental conditions to identify conditional essentiality

How can advanced structural analysis techniques determine the function of ybfF?

Modern structural biology offers powerful approaches to elucidate ybfF function:

  • Homology modeling: Generate three-dimensional models based on related proteins with known structures, as was successfully done with YbxF to identify functionally important regions

  • X-ray crystallography: Determine the atomic structure of purified ybfF protein to identify potential functional domains and binding sites

  • Cryo-electron microscopy (Cryo-EM): Visualize ybfF in complex with its binding partners to understand structural interactions

  • NMR spectroscopy: Analyze the structure and dynamics of ybfF in solution, particularly useful for small proteins

  • Molecular dynamics simulations: Model the behavior and potential interactions of ybfF based on structural data

  • Structure-guided mutagenesis: Use structural information to design targeted mutations of key residues, similar to how researchers identified Lys24 in helix 2 as crucial for YbxF-ribosome interaction

The integration of structural data with functional assays has proven particularly powerful, as demonstrated in the YbxF studies where homology modeling guided the identification of functionally critical residues that were then confirmed through mutational analysis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.