Recombinant Bacillus subtilis Uncharacterized protein ybfG (ybfG)

Shipped with Ice Packs
In Stock

Description

General Information

Bacillus subtilis is a Gram-positive bacterium well-regarded for its ability to produce and secrete proteins, making it a valuable host in biotechnological applications . Recombinant protein production in B. subtilis involves introducing a gene encoding a protein of interest into the bacterium, which then produces the protein . Because Bacillus subtilis has a remarkable ability to absorb and incorporate exogenous DNA into its genome, it is an ideal platform for the heterologous expression of bioactive substances .

FeatureDescription
OrganismBacillus subtilis
Protein TypeUncharacterized protein, designated YbfG
Expression SystemRecombinant; protein produced via genetic engineering
Potential FunctionsWhile the specific function of YbfG is unknown, it may play a role in various cellular processes, including metabolism, stress response, or cell structure. Further research is needed to elucidate its precise function.

Importance of Studying Uncharacterized Proteins

  • Functional Insights: Investigating uncharacterized proteins like YbfG can reveal new metabolic pathways, regulatory mechanisms, and cellular functions in Bacillus subtilis .

  • Biotechnological Potential: Understanding the roles of these proteins may lead to the discovery of novel enzymes, antimicrobial compounds, or other bioactive molecules with industrial or pharmaceutical applications .

  • Comparative Genomics: Analyzing YbfG and its homologs in other bacterial species can provide insights into evolutionary relationships and conserved functions .

Research Approaches

Given that YbfG is an uncharacterized protein, several research approaches can be employed to elucidate its function:

  • Genomics: Analyzing the genomic context of the ybfG gene, including neighboring genes and regulatory elements, can provide clues about its potential role .

  • Proteomics: Identifying YbfG's interacting partners through techniques such as co-immunoprecipitation or affinity purification can help reveal its involvement in protein complexes or pathways .

  • Structural Biology: Determining the three-dimensional structure of YbfG can offer insights into its potential function based on structural similarities to other proteins with known functions.

  • Mutant Analysis: Creating a ybfG knockout mutant and analyzing its phenotype can reveal the protein's involvement in specific cellular processes.

  • Metabolomics: Analyzing the metabolomic profile of a Bacillus subtilis strain with and without YbfG expression can provide insights into the protein's impact on metabolic pathways .

Expression and Purification

Recombinant YbfG can be produced in various expression systems, such as Escherichia coli, yeast, or Bacillus subtilis itself . The choice of expression system depends on factors such as protein yield, solubility, and post-translational modification requirements. Affinity chromatography, such as Ni-NTA or anti-FLAG, is often used to purify recombinant proteins . The purity of the protein can be assessed using SDS-PAGE and Western blotting .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. To ensure preferential development of a specific tag, please indicate your requirements.
Synonyms
ybfG; BSU02200; Uncharacterized protein YbfG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-732
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ybfG
Target Protein Sequence
MVDEMVLITQQWLNDTYSGKHGYNPVEESGKTGWDTIYGLTRALQIELGISEPADNFGPT TQRLFKPLKRQAPDSKPSNMNFILQGALWCKGFNPGGFTGVFYEKTENAVKEFQKAAGLT TQDGIVTTLIMKALLDMSAFKLVSGGDSRIRQIQQNLNRDYNDYIGLMPCDGLYGRDTNK ALIYALQKEEGMSTSVANGFFGNGTTSLCPTLTPGDSRTGFVLIVQYALYCNGKSFDPGE FDGKYGVGVVSAVKAFQEFMCLPQTGYADMPTIKALLSSSGDTTRTASACDTATIITAEK AQTLRNNGYKTVGRYLTGNVRTSSGLTSKALTSKELAVILDAGLKVFPIYQDGGYESSYF VKDQGTRDAYSAASAARRLGFPSGTTIYFAVDFDAYDYEVTDKIIPYFQEIKSAFTKMQT FSTAPKYEIGVYGPRNICIRTSEAGLTKYSFVANMSTGFSGNLGYPMPNNWAFDQFYEGT IGSGSGSIGIDKDGYSGRDSGASNVNPPSDPVYDARLRTLTDILSTIPALENLTSLANAM FEFDTTETIFTSPELDIILSTSLLATIPSEGSPNTITITNGKPGAYITGLLGDTQTSLTA SQIDSYQNLLNSLSLSVRNGYLEVYVNPTAESLNIQIKIYTPDIPVGDNVTTGLTTTITF KIKTYKGVPVTSPESELALDWPSYDQYLFPVVGVAALLLIGNMGSDLTNNKGVKVATALS AMLLAIFAYYTS
Uniprot No.

Target Background

Database Links
Protein Families
FadG family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What makes Bacillus subtilis a suitable model organism for studying uncharacterized proteins like ybfG?

Bacillus subtilis serves as an ideal model organism for studying uncharacterized proteins due to several key advantages. As a Gram-positive bacterium with a fully sequenced genome, B. subtilis grows rapidly under laboratory conditions and possesses natural competence, allowing it to take up foreign DNA and integrate it into its genome . This characteristic significantly simplifies genetic manipulation experiments, making it easier to express, delete, or modify proteins of interest like ybfG.

Additionally, B. subtilis functions as a model organism for the entire Firmicutes phylum, which includes many important Gram-positive pathogens such as Bacillus anthracis, Staphylococcus aureus, and Listeria monocytogenes . This relationship allows researchers to extrapolate findings about uncharacterized proteins in B. subtilis to related organisms with greater pathogenic relevance, while working in a safer, non-pathogenic system.

What are the standard methods for cloning and expressing the ybfG gene from Bacillus subtilis?

Standard methods for cloning and expressing the ybfG gene from B. subtilis typically follow these established protocols:

  • Gene Amplification: PCR amplification of the ybfG gene using high-fidelity DNA polymerase with primers containing appropriate restriction sites for subsequent cloning.

  • Vector Selection: For B. subtilis proteins, expression systems can be established in either:

    • Homologous system (within B. subtilis) using vectors like pHT01 or pHT43

    • Heterologous system (E. coli) using vectors like pET series for high-yield expression

  • Transformation Approach: Transform the recombinant vector into the expression host using either:

    • Chemical transformation (CaCl₂ method) for E. coli hosts

    • Natural competence induction for B. subtilis hosts

  • Expression Optimization: Typical conditions include:

    ParameterB. subtilis ExpressionE. coli Expression
    Temperature30-37°C16-37°C
    InductionIPTG (0.1-1.0 mM)IPTG (0.1-1.0 mM)
    Time4-24 hours4-18 hours
    MediaLB or Minimal MediaLB, TB, or 2YT
  • Protein Tagging: Addition of affinity tags (His-tag, YFP/GFP) facilitates purification and visualization, with fluorescent tags being particularly useful for localization studies and expression monitoring .

What bioinformatic approaches can predict potential functions of uncharacterized proteins like ybfG?

To predict potential functions of uncharacterized proteins like ybfG, researchers employ a multi-layered bioinformatic approach:

  • Sequence Homology Analysis:

    • BLAST searches against protein databases to identify similar characterized proteins

    • Multiple sequence alignments to identify conserved domains and motifs

    • Phylogenetic analysis to determine evolutionary relationships

  • Structural Prediction:

    • Secondary structure prediction using algorithms like PSIPRED or JPred

    • Tertiary structure modeling using homology modeling (SWISS-MODEL) or ab initio approaches (I-TASSER, AlphaFold)

    • Analysis of predicted binding sites and pockets

  • Functional Annotation:

    • Gene ontology (GO) term prediction

    • Protein family (Pfam) analysis

    • Identification of conserved domains using databases like CDD or InterPro

  • Genomic Context Analysis:

    • Examination of gene neighborhood to identify co-regulated genes

    • Analysis of operonic structure and potential co-transcription with functionally related genes

    • Comparative genomics across related Bacillus species

  • Network Analysis:

    • Protein-protein interaction prediction

    • Integration with existing protein interaction networks

    • Co-expression analysis with genes of known function

The integration of these approaches can provide strong hypotheses about the function of ybfG, directing subsequent experimental validation efforts.

How can single-subject experimental designs be applied to characterize the phenotypic effects of ybfG deletion or overexpression?

Single-subject experimental designs (SSEDs) can be effectively adapted to characterize phenotypic effects of ybfG manipulation by applying the following methodological framework:

  • Establish Baseline Phase (A):

    • Measure multiple defined parameters in wild-type B. subtilis (growth rate, morphology, stress response) systematically over time

    • Collect at least five data points per phase as recommended by WWCH panel standards

    • Ensure measurements by multiple assessors with interassessor agreement on at least 20% of data points

  • Intervention Phase (B):

    • Introduce genetic manipulation (ybfG deletion or overexpression)

    • Continue systematic measurement of the same parameters under identical conditions

    • Document any changing trends, levels, or variability in measured parameters

  • Withdrawal/Reversal Phase (A):

    • If ethically and technically feasible, restore wild-type conditions using complementation or regulated expression systems

    • Monitor for reversal of phenotypic changes

  • Reintroduction Phase (B):

    • Reintroduce the genetic manipulation to confirm reproducibility of effects

    • This ABAB design provides powerful evidence of causality through within-study replication

  • Analysis Guidelines:

    • Use visual analysis to identify changes in level, trend, and variability between phases

    • Be cautious of latent effects, as illustrated in Figure 2A of reference

    • Apply WWCH panel standards to evaluate experimental evidence strength

This approach is particularly valuable for phenotypes that may vary among individual cells or colonies, allowing researchers to distinguish true effects from normal biological variability.

What are the optimal fluorescent protein fusion strategies for studying ybfG localization and dynamics in living B. subtilis cells?

Implementing fluorescent protein fusions for studying ybfG localization requires careful consideration of several technical aspects:

  • Fusion Orientation Selection:

    • N-terminal vs. C-terminal fusions should be evaluated based on predicted protein structure and function

    • Both orientations should be tested when possible, as incorrect fusion placement can disrupt localization signals or protein function

  • Fluorescent Protein Selection:

    Fluorescent ProteinAdvantagesLimitationsOptimal Application
    GFP/YFP variantsWell-established in B. subtilis, direct visualization, selection by FACSCan aggregate, slower maturationGeneral localization studies
    mCherry/mRFPRed-shifted spectrum allows multi-color imagingLower brightness than GFPCo-localization with GFP-tagged proteins
    mNeonGreenBright signal, fast maturationLess established in B. subtilisDynamic studies requiring strong signal
    Superfolder GFPImproved folding in secretory pathwayLarger sizeStudies of secreted or transmembrane proteins
  • Expression Control:

    • Native promoter expression maintains physiological levels but may result in low signal

    • Inducible promoters (Pxyl, Pspac) allow titration of expression levels

    • For time-lapse studies, photobleaching resistance becomes critical

  • Validation Approaches:

    • Complementation assays to verify fusion protein functionality

    • Co-localization with known cellular markers

    • Controls for artifactual aggregation or mislocalization

    • Correlation with immunofluorescence using antibodies when available

  • Advanced Imaging Techniques:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein dynamics

    • Time-lapse microscopy with microfluidics to track localization through cell cycles

    • Super-resolution techniques (STED, PALM) to overcome diffraction limits

This systematic approach, drawing on techniques established for studying MreB localization in B. subtilis , provides the methodological framework for characterizing ybfG spatial and temporal dynamics.

How can contradictory experimental results regarding ybfG function be reconciled through careful experimental design?

Reconciling contradictory results regarding protein function requires systematic investigation through carefully designed experiments:

  • Identify Potential Variability Sources:

    • Strain background differences (laboratory strains vs. environmental isolates)

    • Growth conditions and media composition

    • Expression levels in different experimental systems

    • Methodological differences in assays and measurements

  • Implement Controlled Comparison Studies:

    • Direct side-by-side experiments using standardized protocols

    • Replicate key experiments in both experimental systems showing contradictory results

    • Exchange strains and materials between laboratories reporting discrepancies

  • Multiple Evidence Lines Approach:

    • Apply orthogonal techniques to measure the same parameter

    • For example, if protein-protein interactions show inconsistencies:

      • Verify interactions using both in vivo (bacterial two-hybrid) and in vitro (pull-down) methods

      • Supplement with structural studies and biophysical measurements

  • Isolate Experimental Variables:

    • Systematic variation of individual experimental parameters

    • The historical example from B. subtilis research is illustrative: contradictory findings about SigF regulation were ultimately resolved by recognizing that both protein-protein interactions and protein kinase activity were involved in its regulation

  • Integration Framework:

    • Develop models that can accommodate seemingly contradictory data

    • Consider context-dependent functions that may change under different conditions

    • Implement statistical approaches to distinguish true effects from experimental noise

Through this systematic approach, researchers can transform apparent contradictions into more comprehensive understanding, as exemplified by historical controversies in B. subtilis research that led to unified models once integrated .

What purification strategies yield the highest activity and purity of recombinant ybfG protein?

Optimizing purification of recombinant ybfG protein requires a strategic approach to maximize both yield and biological activity:

  • Expression System Selection:

    • For structural studies requiring high yields: E. coli BL21(DE3) with pET vectors

    • For functional studies requiring proper folding: B. subtilis expression systems

    • For challenging proteins: Consider human HEK293F cell expression with YFP fusion tags, which has been shown to produce high yields of properly folded recombinant proteins

  • Affinity Tag Strategy:

    Tag TypeAdvantagesPurification MethodConsiderations
    His6-tagSmall size, minimal interferenceIMAC (Ni-NTA)Can bind non-specifically to metal-binding proteins
    GST-tagEnhances solubilityGlutathione resinLarge tag may affect function
    YFP/GFPVisual tracking, fluorescent quantificationAnti-GFP/YFP nanobody sepharoseHigh stringency, high affinity purification
    Dual tagsSequential purification enhances purityTwo-step purificationAdded complexity and potential yield loss
  • Optimized Purification Protocol:

    • Cell lysis under mild conditions (example: with non-ionic detergent NP-40)

    • Direct visualization of binding to resin when using fluorescent tags

    • Implement tag removal using precision proteases like TEV protease

  • Additional Purification Steps:

    • Ion exchange chromatography to separate different oligomeric states

    • Size exclusion chromatography for final polishing and buffer exchange

    • Consider the approach used for TOP2β purification, combining affinity purification with sequential ion exchange and size-exclusion chromatography

  • Quality Control Metrics:

    • SDS-PAGE and western blotting to assess purity and degradation

    • Dynamic light scattering to evaluate homogeneity

    • Activity assays specific to predicted function

    • Thermal shift assays to assess protein stability

This multi-step approach, drawing on successful strategies used for challenging proteins like human Topoisomerase 2, can be adapted for ybfG purification while monitoring yield and activity throughout the process.

What are the most effective techniques for determining protein-protein interactions involving ybfG in B. subtilis?

Investigating protein-protein interactions involving uncharacterized proteins like ybfG requires a multi-technique approach:

  • In Vivo Techniques:

    • Bacterial Two-Hybrid (B2H): Adaptation of yeast two-hybrid for bacterial systems, less prone to false positives in B. subtilis proteins

    • Fluorescence Resonance Energy Transfer (FRET): Fusion of potential interaction partners with compatible fluorophores (e.g., CFP/YFP pairs)

    • Split-Fluorescent Protein Complementation: Fragments of fluorescent proteins are fused to potential interaction partners, with fluorescence occurring only upon interaction

    • In vivo Crosslinking: Chemical crosslinkers (formaldehyde, DSS) stabilize transient interactions prior to cell lysis and analysis

  • Affinity-Based Methods:

    • Co-immunoprecipitation (Co-IP): Using antibodies against ybfG or tagged versions

    • Pull-Down Assays: Using recombinant tagged ybfG as bait

    • Tandem Affinity Purification (TAP): Dual tags improve specificity

    • BioID or APEX Proximity Labeling: Fusion of ybfG to biotin ligase or peroxidase to label proximal proteins

  • Global Approaches:

    • Affinity Purification-Mass Spectrometry (AP-MS): Comprehensive identification of interaction partners

    • Chemical Crosslinking-MS: Identifies interaction interfaces

    • Protein Microarrays: Testing interactions against libraries of B. subtilis proteins

  • Validation Approaches:

    TechniqueAdvantagesLimitationsData Output
    Surface Plasmon Resonance (SPR)Real-time kinetics, no labels neededRequires purified proteinsBinding constants (Ka, Kd)
    Isothermal Titration Calorimetry (ITC)Thermodynamic parametersLow throughput, sample intensiveΔH, ΔS, Kd
    Microscale Thermophoresis (MST)Low sample amounts, solution-basedRequires fluorescent labelingBinding affinity curves
    Native Mass SpectrometryDirect observation of complexesSpecialized equipmentComplex composition and stoichiometry
  • Data Integration Strategy:

    • Prioritize interactions identified by multiple methods

    • Create interaction maps with confidence scores

    • Connect to known protein networks in B. subtilis

    • Validate key interactions with functional studies

This comprehensive approach, leveraging both targeted and global methods, maximizes the chance of identifying genuine interaction partners while minimizing false positives.

How can CRISPR-Cas9 technology be optimized for genetic manipulation of ybfG in B. subtilis?

Optimizing CRISPR-Cas9 for genetic manipulation of ybfG in B. subtilis requires specific considerations:

  • CRISPR-Cas9 System Adaptation for B. subtilis:

    • Selection of appropriate Cas9 expression system (constitutive vs. inducible)

    • Codon optimization of Cas9 for B. subtilis

    • Evaluation of different sgRNA delivery methods (plasmid-based vs. genomic integration)

  • sgRNA Design Strategy:

    • Target selection within ybfG with minimal off-target effects

    • Recommended parameters:

      • GC content between 40-60%

      • Avoid homopolymer runs (4+ identical nucleotides)

      • Target 5' region of gene for complete knockouts

      • Consider PAM accessibility in the genomic context

  • Editing Approach Selection:

    Editing GoalRecommended MethodRepair TemplateSelection Strategy
    Gene KnockoutCRISPR-Cas9 + HDRHomology arms (500-1000bp) flanking resistance markerAntibiotic selection
    Point MutationsBase editors (BE4, ABE)Not requiredFACS if using fluorescent markers
    Protein TaggingCRISPR-Cas9 + HDRybfG + tag sequence + homology armsFluorescence selection if using GFP/YFP
    Regulatable ExpressionCRISPRi (dCas9)Not requiredInducible repression verification
  • Optimization Protocol:

    • Evaluate transformation efficiency with control targets

    • Test different sgRNA sequences targeting ybfG

    • Optimize homology arm length for precise modifications

    • Compare HDR templates (linear DNA vs. plasmid)

  • Validation Methods:

    • PCR screening of transformants

    • Sequencing to confirm precise edits

    • Expression analysis (qRT-PCR, Western blot)

    • Phenotypic characterization of mutants

  • Troubleshooting Common Issues:

    • Low editing efficiency: Test alternative sgRNAs, increase homology arm length

    • Off-target effects: Verify specificity with whole-genome sequencing

    • Toxicity of Cas9: Use tightly controlled inducible promoters

    • Plasmid stability: Consider integrating Cas9 into neutral loci in the genome

This systematic approach leverages the fluorescent protein expertise from reference and combines it with B. subtilis genetic manipulation principles from reference to optimize CRISPR-Cas9 editing of ybfG.

How should researchers design experiments to distinguish direct vs. indirect effects of ybfG mutation on B. subtilis physiology?

Designing experiments to differentiate direct from indirect effects requires systematic experimental approaches:

  • Immediate vs. Delayed Response Analysis:

    • Implement time-course experiments after inducible ybfG expression/deletion

    • Early responses (minutes to hours) are more likely direct effects

    • Apply analytical approaches similar to those used in single-subject experimental designs to detect immediate vs. delayed changes

  • Genetic Suppressor Screening:

    • Generate secondary mutations that suppress ybfG mutation phenotypes

    • Suppressors often identify genes in the same pathway or directly interacting partners

    • Implementation through:

      • Random mutagenesis and selection for phenotype reversion

      • Targeted deletion/overexpression of candidate interacting partners

  • Biochemical Validation Framework:

    • In vitro reconstitution of proposed direct activities

    • Requirements for demonstrating direct effects include:

      • Purified components showing activity

      • Specific binding between ybfG and proposed targets

      • Structure-function analysis with point mutations affecting specific interactions

  • Multi-omics Integration Approach:

    TechniqueApplicationDirect Effect EvidenceIndirect Effect Pattern
    RNA-SeqTranscriptional changesFew specific targetsBroad stress responses
    ProteomicsProtein level changesCo-purification with ybfGSecondary adaptation
    MetabolomicsMetabolic alterationsChanges in specific pathwaysGlobal metabolic shifts
    ChIP-SeqGenomic binding sitesDirect DNA/chromosome interactionNo enrichment
  • Controlled Complementation Testing:

    • Expression of ybfG under inducible promoters to titrate levels

    • Dose-response relationships with tight temporal control

    • Domain deletion variants to map functional regions

By integrating these approaches with visual analysis methods described in reference , researchers can establish causal relationships between ybfG and observed phenotypes, distinguishing primary effects from secondary cellular responses.

What statistical approaches are most appropriate for analyzing high-throughput data related to ybfG function?

Selecting appropriate statistical methods for high-throughput data analysis requires careful consideration of data structure and experimental design:

  • Differential Expression Analysis:

    • For RNA-Seq data comparing ybfG mutants to wild-type:

      • DESeq2 or EdgeR for count-based differential expression

      • LIMMA for microarray or normalized count data

    • Multiple testing correction is essential (Benjamini-Hochberg preferred over Bonferroni)

    • Visual validation through MA plots and volcano plots

  • Functional Enrichment Analysis:

    • Gene Ontology (GO) enrichment using:

      • DAVID, g:Profiler, or PANTHER

      • Fisher's exact test or hypergeometric test for overrepresentation

    • Pathway analysis using KEGG or Reactome databases

    • Protein domain enrichment through InterPro or Pfam

  • Network Analysis Approaches:

    • Protein-Protein Interaction networks:

      • Markov Clustering or MCODE for module detection

      • Betweenness centrality to identify key nodes

    • Co-expression networks:

      • WGCNA (Weighted Gene Correlation Network Analysis)

      • Cytoscape visualization with enrichment mapping

  • Time-Series Data Analysis:

    • For temporal responses to ybfG manipulation:

      • Autoregressive integrated moving average (ARIMA) models

      • Functional data analysis (FDA) for continuous trajectories

      • Visual analysis approaches from single-subject designs

  • Multi-omics Data Integration:

    Integration MethodAppropriate ForStatistical ApproachVisualization
    Concatenation-basedData sets of same typePCA, t-SNE, UMAPDimensionality reduction plots
    Correlation-basedRelationships between omics layersSparse CCA, MOFACorrelation heatmaps
    Network-basedSystem-level interactionsSimilarity Network FusionMulti-layered network graphs
    Model-basedCausal relationshipsBayesian NetworksDirected acyclic graphs
  • Replication and Validation Strategy:

    • Technical replicates: Control for measurement error

    • Biological replicates: Account for biological variation

    • Cross-validation: Split-sample or leave-one-out approaches

    • Independent experimental validation of key findings

This comprehensive statistical framework ensures robust interpretation of high-throughput data while controlling for false discoveries, leading to reliable hypotheses about ybfG function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.