Recombinant Bacillus subtilis Uncharacterized protein ycbO (ycbO)

Shipped with Ice Packs
In Stock

Description

Molecular and Genetic Characteristics

YcbO is encoded by the ycbO gene (locus tag: BSU02580) and classified under UniProt ID P42247. The protein comprises 228 amino acids with a predicted molecular weight of approximately 25 kDa. Key sequence features include transmembrane domains and conserved motifs associated with bacterial membrane proteins .

Recombinant Production and Applications

Recombinant YcbO is produced in heterologous systems (e.g., E. coli) for structural and functional studies. Key production details include:

  • Expression: Optimized codon usage for high-yield soluble protein .

  • Purification: Affinity chromatography via His-tag, followed by size-exclusion chromatography for monomeric isolation .

  • Stability: Liquid or lyophilized forms retain activity under recommended storage conditions .

Research Applications

  • Antibody production: Recombinant YcbO serves as an antigen for polyclonal antibody generation .

  • Protein interaction studies: Used in yeast two-hybrid screens to identify binding partners .

  • Structural biology: Crystallization trials to resolve 3D architecture and infer function .

Context in Bacillus subtilis Biology

YcbO is part of a broader landscape of uncharacterized proteins in B. subtilis, which constitute ~40% of its genome . Comparative genomics reveals:

  • Operonic associations: ycbO is not part of a known operon but is flanked by genes involved in cell envelope biogenesis .

  • Regulatory networks: Potential regulation by transition-state regulators like SigB or CodY, based on promoter analysis .

Challenges and Future Directions

  • Functional annotation: Targeted knockouts or CRISPRi-based repression could elucidate phenotypic impacts .

  • Interactome mapping: Co-purification/mass spectrometry to identify binding partners .

  • Structural resolution: Cryo-EM or X-ray crystallography to uncover active sites or ligand-binding pockets .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order, and we will fulfill it if available.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice is required, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial before opening to ensure the contents are at the bottom. We recommend reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term stability, we suggest adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles to maintain optimal product quality.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ycbO; BSU02580; Uncharacterized protein YcbO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ycbO
Target Protein Sequence
MNLIRIELRKMKMGWYIRGALIANVIIMGFMWLISYSEKADGGVSFQSTDEAFLIIGTFV RAVFIVFGAVLIVKLVISEYKNKTILVMFTYPISRKKLLTAKLMIAGGLTFITILLSNIL IAAGFFWLNSICHFIPGELTSEIISQQAVKMAVFAFGAAGTSLVPIFFGMRRHSVPATII SSVVIVMLISSTSPGFSISSVVYIPLSLAAFGLFFSYMAIRNADKQDA
Uniprot No.

Target Background

Database Links

KEGG: bsu:BSU02580

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Bacillus subtilis ycbO and why is it classified as "uncharacterized"?

    The ycbO protein (gene name: ycbO, locus: BSU02580) is a 228-amino acid transmembrane protein encoded by the Bacillus subtilis genome . It is classified as "uncharacterized" because its biological function has not been experimentally validated, despite the complete sequencing of the B. subtilis strain 168 genome. Many proteins identified through genomic sequencing initially receive this designation until their functions are determined through targeted research .

    Methodological approach: To begin characterizing such proteins, researchers typically employ a combination of bioinformatic analyses (sequence homology, structural predictions), gene knockout studies, and protein-protein interaction experiments to develop hypotheses about function.

  • What are the physical and structural characteristics of the ycbO protein?

    The ycbO protein has the following characteristics:

    • Molecular weight: 25,062 Da

    • Full length: 228 amino acids

    • Nature: Transmembrane protein

    • Predicted structure: Contains multiple transmembrane helices based on its hydrophobic sequence regions

    PropertyValueMethod of Determination
    Molecular Weight25,062 DaCalculated from amino acid sequence
    Amino Acid Count228 aaComplete sequence analysis
    Protein TypeTransmembraneHydropathy analysis of sequence
    Secondary StructureMultiple transmembrane helicesPredicted from sequence analysis
  • How should recombinant ycbO protein be properly stored and handled?

    For optimal stability and activity, recombinant ycbO protein should be:

    • Stored at -20°C, or -80°C for extended storage

    • Aliquoted to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

    • Typically maintained in a Tris-based buffer with 50% glycerol

    Small volumes may occasionally become entrapped in the seal of product vials during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container's cap .

Advanced Research Questions

  • What computational approaches are recommended for predicting the function of ycbO?

    A comprehensive computational strategy should include:

    1. Sequence-based analysis:

      • BLAST searches against characterized proteins

      • Multiple sequence alignment with homologous proteins

      • Identification of conserved domains using databases like Pfam, PROSITE, or InterPro

    2. Structure-based predictions:

      • Ab initio protein structure modeling

      • Homology modeling if structural homologs exist

      • Molecular dynamics simulations to identify potential binding sites

    3. Genomic context analysis:

      • Examination of neighboring genes in the B. subtilis genome

      • Comparative genomics across bacterial species

      • Analysis of gene expression patterns under various conditions

    4. Protein-protein interaction predictions:

      • Screening for potential interaction partners based on co-expression

      • Computational docking studies with predicted partners

  • How does ycbO fit into the broader context of uncharacterized proteins in Bacillus subtilis?

    B. subtilis contains numerous uncharacterized proteins, with approximately 900 of its ~4,100 genes having unknown functions . The characterization of these proteins represents a significant research frontier. The ycbO protein is particularly interesting because:

    • It belongs to the transmembrane protein category, which is typically more challenging to study

    • Like many uncharacterized proteins in B. subtilis, it may be involved in specific stress responses or environmental adaptations

    • Understanding ycbO could provide insights into membrane functions or signaling pathways

    Research approach: Comparative functional genomics studies that analyze multiple uncharacterized proteins simultaneously can reveal patterns of co-regulation or co-functionality, potentially placing ycbO in a functional network.

  • What experimental approaches can determine if ycbO interacts with other known membrane systems in B. subtilis?

    The following methods are particularly suitable for investigating membrane protein interactions:

    1. Bacterial two-hybrid system adapted for membrane proteins

    2. Co-immunoprecipitation using antibodies against ycbO

    3. FRET (Fluorescence Resonance Energy Transfer) for in vivo interaction studies

    4. Cross-linking experiments followed by mass spectrometry

    5. Lipid bilayer reconstitution to study direct protein-protein interactions

    6. Split-GFP complementation for visualizing interactions in bacterial cells

    When designing these experiments, consider that B. subtilis exhibits compartmentalized membranes during processes like sporulation and competence development, which may affect protein localization and interactions .

  • What gene expression patterns might reveal about ycbO function?

    Analysis of transcriptomic data could reveal conditions where ycbO is differentially expressed:

    • Stress responses (thermal, oxidative, nutrient limitations)

    • Growth phase transitions (exponential vs. stationary)

    • Specialized developmental processes like sporulation or competence

    For example, if ycbO shows expression patterns similar to genes involved in competence development (like the comK regulon), this might suggest a role in natural transformation processes . Alternatively, co-expression with genes involved in specific metabolic pathways could indicate functional relationships.

    Methodological approach: RNA-seq analysis under various conditions, combined with clustering of co-expressed genes, can place ycbO within functional networks based on expression patterns .

Experimental Design

  • How should researchers design a knockout experiment to determine ycbO function?

    A comprehensive ycbO knockout study should include:

    1. Gene deletion strategy:

      • Create a clean deletion using double crossover recombination

      • Consider using a marker-free approach to avoid polar effects

      • Create both knockout and complemented strains for validation

    2. Phenotypic assays:

      • Growth curves under standard conditions and various stresses

      • Microscopic examination of cell morphology

      • Membrane integrity tests (using fluorescent dyes)

      • Competence and sporulation efficiency measurements

    3. Comparative transcriptomics/proteomics:

      • RNA-seq comparing wildtype and knockout strains

      • Proteome analysis to identify compensatory responses

      • Particular focus on other membrane proteins that may be affected

    4. Environmental adaptability tests:

      • Various temperatures (20°C, 37°C, 45°C)

      • Nutrient limitation conditions

      • Antimicrobial resistance profiling

    Given B. subtilis' ability to form robust biofilms and spores, phenotypic differences may only manifest under specific developmental or stress conditions .

  • What are the optimal conditions for expressing and purifying recombinant ycbO for structural studies?

    For membrane proteins like ycbO, consider this optimized protocol:

    1. Expression system selection:

      • E. coli C41(DE3) or C43(DE3) strains designed for membrane protein expression

      • Consider cell-free expression systems for difficult membrane proteins

      • Alternative: Bacillus expression systems for native-like membrane environment

    2. Expression conditions:

      • Induction: Low IPTG concentration (0.1-0.5 mM) at reduced temperature (16-20°C)

      • Extended expression time (overnight)

      • Supplementation with specific lipids may improve folding

    3. Purification strategy:

      • Membrane isolation by ultracentrifugation

      • Solubilization with mild detergents (DDM, LMNG, or amphipols)

      • Affinity chromatography using engineered tags

      • Size exclusion chromatography for final purification

    4. Quality control:

      • Circular dichroism to confirm secondary structure

      • Thermal stability assays

      • Single-particle negative stain EM to verify homogeneity

  • How can researchers design experiments to determine if ycbO is involved in competence development?

    Given the importance of competence in B. subtilis biology , a methodical approach would include:

    1. Transformation efficiency measurements:

      • Compare natural competence development between wildtype and ΔycbO strains

      • Quantify DNA uptake using fluorescently labeled DNA

      • Test complementation with ycbO expressed in trans

    2. Gene expression analysis:

      • Monitor expression of key competence genes (comK, comG) in the ycbO mutant

      • Use fluorescent reporters fused to competence promoters

      • Determine if ycbO expression coincides with competence development

    3. Protein localization studies:

      • Fluorescent tagging of ycbO to track localization during competence

      • Co-localization with known competence apparatus components

      • Immunogold electron microscopy for precise localization

    4. Interaction studies:

      • Pull-down assays with known competence proteins

      • Bacterial two-hybrid screening for interactions with competence components

      • In vivo cross-linking during competence development

  • What approaches can be used to investigate whether ycbO is involved in copper homeostasis like other uncharacterized B. subtilis proteins?

    Based on findings about other uncharacterized B. subtilis proteins that function in copper homeostasis , investigate ycbO's potential role through:

    1. Metal binding assays:

      • Inductively coupled plasma mass spectrometry (ICP-MS) to quantify bound copper

      • Electron paramagnetic resonance (EPR) spectroscopy to characterize copper binding

      • Isothermal titration calorimetry to determine binding affinity

    2. Physiological experiments:

      • Growth phenotypes in copper-limited and copper-excess conditions

      • Compare with known copper homeostasis mutants (e.g., ycnJ, ycnK, ycnI)

      • Measure intracellular copper levels in wildtype vs. ΔycbO strains

    3. Genetic interaction studies:

      • Create double mutants with known copper homeostasis genes

      • Test for synthetic phenotypes under copper stress

      • Examine expression patterns under copper limitation/excess

    4. Structural analysis:

      • Look for potential copper-binding motifs (His, Cys, Met residues)

      • Compare with the monohistidine brace identified in YcnI

      • X-ray crystallography of purified protein with/without copper

Data Analysis and Interpretation

  • How should researchers analyze RNA-seq data to identify potential functions of ycbO?

    A systematic approach to RNA-seq data analysis would include:

    1. Differential expression analysis:

      • Compare wildtype vs. ΔycbO strains under multiple conditions

      • Identify consistently up/down-regulated genes across conditions

      • Apply appropriate statistical thresholds (adjusted p-value < 0.05, log2FC > 1)

    2. Functional enrichment analysis:

      • Gene Ontology (GO) term enrichment among differentially expressed genes

      • KEGG pathway analysis to identify affected biological processes

      • Regulon analysis to identify affected transcription factor networks

    3. Co-expression network construction:

      • Build networks of co-expressed genes using WGCNA or similar approaches

      • Identify modules of genes with similar expression patterns

      • Place ycbO within this network structure

    4. Integration with existing datasets:

      • Compare with publicly available B. subtilis transcriptome data

      • Integrate with chromatin immunoprecipitation (ChIP-seq) data for key regulators

      • Cross-reference with proteomics data when available

    The DISCLOSE software mentioned in search result can be particularly useful for combining clustering with functional information and identifying regulatory motifs within clusters.

  • How can contradictory results in ycbO functional studies be reconciled?

    When faced with contradictory data about ycbO function, implement this reconciliation framework:

    1. Experimental condition analysis:

      • Compare temperature, media composition, and growth phase across studies

      • B. subtilis exhibits dramatically different behaviors at different temperatures (e.g., 20°C vs. 37°C vs. 45°C)

      • Consider strain background differences (laboratory strains vs. environmental isolates)

    2. Methodology assessment:

      • Evaluate sensitivity and specificity of different assays

      • Consider whether membrane protein purification methods maintained native structure

      • Assess whether genetic manipulations caused polar effects on adjacent genes

    3. Hypothesis refinement:

      • Develop a model incorporating seemingly contradictory results

      • Consider multifunctional nature of many bacterial proteins

      • Test for condition-specific functions

    4. Validation experiments:

      • Design experiments specifically targeting the contradictions

      • Use complementary techniques that approach the question differently

      • Consider collaboration with labs reporting contradictory results

  • What statistical approaches are appropriate for analyzing phenotypic data from ycbO mutant studies?

    For rigorous analysis of phenotypic data:

    1. Experimental design considerations:

      • Use appropriate sample sizes based on power analysis

      • Include biological and technical replicates

      • Design factorial experiments when studying multiple variables

    2. Statistical tests selection:

      • Growth curves: Repeated measures ANOVA or growth rate calculations with t-tests

      • Survival assays: Log-rank tests for time-to-event data

      • Gene expression: DESeq2 or similar tools for RNA-seq, t-tests for qPCR

      • Microscopy data: Image analysis with appropriate morphometric statistics

    3. Multiple testing correction:

      • Apply FDR correction (Benjamini-Hochberg) for multiple comparisons

      • Use FWER methods (Bonferroni) when strong control is needed

    4. Data visualization:

      • Present complete datasets rather than cherry-picked examples

      • Use consistent scales and appropriate error bars

      • Consider dimensional reduction techniques for complex datasets

    Reference to established data table design principles will enhance analysis quality and reproducibility .

Applications and Future Directions

  • How might characterizing ycbO contribute to understanding bacterial transmembrane signaling?

    A characterized ycbO could advance our understanding of bacterial signaling through:

    1. Novel signaling mechanisms:

      • Potentially uncovering new classes of membrane receptors

      • Identifying unique signal transduction pathways

      • Understanding condition-specific membrane responses

    2. Bacterial adaptation systems:

      • Insight into how bacteria sense and respond to environmental changes

      • Understanding membrane remodeling during stress responses

      • Elucidating communication between different cellular compartments

    3. Evolutionary perspectives:

      • Comparing functionally characterized ycbO with homologs in other bacteria

      • Understanding conservation of membrane signaling systems

      • Identifying bacterial lineage-specific innovations in membrane biology

    4. Biotechnological applications:

      • Engineering bacteria with improved sensing capabilities

      • Developing new reporter systems based on membrane signaling

      • Creating synthetic biology tools for controlled gene expression

  • What potential roles might ycbO play in Bacillus subtilis sporulation or germination processes?

    Based on the complex developmental processes in B. subtilis , ycbO could function in:

    1. Sporulation signaling:

      • Environmental sensing triggering sporulation

      • Compartment-specific signaling during asymmetric division

      • Regulation of mother cell-forespore communication

    2. Spore structure development:

      • Membrane remodeling during forespore maturation

      • Assembly of germination receptors

      • Formation of specialized membrane domains

    3. Germination mechanisms:

      • Nutrient sensing during germination

      • Membrane permeability changes during spore revival

      • Signal transduction during outgrowth

    Experimental approach: Create fluorescently tagged ycbO and track its localization throughout the sporulation and germination cycle, combined with sporulation/germination efficiency assays in the knockout strain .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.