Recombinant Bacillus subtilis Uncharacterized protein ycbP (ycbP)

Shipped with Ice Packs
In Stock

Description

Lack of Specific Data on ycbP

The search results focus on well-characterized B. subtilis recombinant proteins and expression systems, including:

  • YITB (Source ): A recombinant protein with a known sequence (MNETITYDTWNDMLSKQITDQLIDELDVLKWAYRTYGEKIVYACSFGAEGMVLLDLISKINKNAHIIFLDTGLHFQETYELIETVKERYPGFAIQMLEPELSLTEQGTKYGGELWKHNPNLCCQLRKIEPLKKHLSGMTAWISGLRRDQSPTRKHIQYVNLDQKFELIKICPLIHWTWDDVWTYIRLHNLPYNKLHDQHYPSIGCEMCTLPSPDPNDERAGRWAGREKTECGLHQE).

  • YjbA (Source ): A ClpC adaptor protein involved in sporulation, with structural insights from co-crystal studies.

  • Pylb (Source ): A stationary-phase promoter driving high expression of target genes (e.g., egfp, mApple).

No studies explicitly mention ycbP, its function, or its recombinant production.

Potential Confusion with Related Proteins

The term "ycbP" may overlap with other B. subtilis genes, such as:

Gene/ProteinFunction/RoleExpression ContextSource
YlbPStationary-phase gene; part of promoter selection for recombinant expressionDriven by Pylb promoter in B. subtilis
YddFStress-response protein; candidate for promoter-driven expressionHigh β-galactosidase activity in stationary phase
YITBUncharacterized protein (OPCA179865); available as recombinant protein>85% purity via SDS-PAGE

**General Insights into B. subtilis Recombinant Protein Production

While ycbP-specific data is absent, B. subtilis remains a robust platform for recombinant protein production due to:

Key Features of B. subtilis Expression Systems

AdvantageMechanismExample
Secretion EfficiencySignal peptides (e.g., CotG) direct proteins to extracellular mediumRabies virus G protein expressed via CotG fusion (Source )
Inducible PromotersPylb, P43, and IPTG-regulated systems enable controlled expressionPylb drives 7.8–11.3× higher expression than P43 (Source )
Protease RegulationChaperones (e.g., PrsA) prevent degradation; ClpC/YjbA systems manage substrate turnoverYjbA recruits ClpCP for spore maturation (Source )

Recommendations for Further Research

To address the gap in ycbP data:

  1. Verify Nomenclature: Cross-check NCBI Gene ID or UniProt entries for ycbP.

  2. Explore Homologs: Screen B. subtilis genome databases for proteins with similar sequences to ycbP.

  3. Recombinant Production: Use established B. subtilis systems (e.g., Pylb promoter, CotG secretion) to express ycbP if cloning is feasible.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycbP; BSU02590; Uncharacterized protein YcbP; ORF15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ycbP
Target Protein Sequence
MTHVKALAIKGIMTIIVLYLVLGLGFGFTFGDTLLMTIVLGVISYLLGDLYVLPKWNNMI ATLADFGLAFLVIWLMGMPLSMGMTGGEVALAALFGAIVMAIGEYCFHFYMMSKEIGKKH YLETRTDS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.