Recombinant Bacillus subtilis Uncharacterized protein yckC (yckC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Uncharacterized Protein yckC (yckC)

Recombinant Bacillus subtilis Uncharacterized protein yckC (yckC) is a protein derived from the bacterium Bacillus subtilis, a Gram-positive, rod-shaped bacterium commonly found in soil and the gastrointestinal tracts of animals. This protein is expressed in Escherichia coli (E. coli) and is tagged with a His-tag at its N-terminal end for easy purification and identification . The yckC protein is part of a broader category of uncharacterized proteins, meaning its specific biological function has not been fully elucidated.

Characteristics of Recombinant Bacillus subtilis Uncharacterized Protein yckC (yckC)

  • Protein Length and Structure: The recombinant yckC protein is a full-length protein consisting of 151 amino acids (1-151aa) .

  • Expression Host: It is expressed in E. coli, a common host for recombinant protein production due to its well-understood genetics and ease of manipulation .

  • Tagging: The protein is fused with an N-terminal His-tag, which facilitates purification using affinity chromatography .

  • Purity and Form: The protein is available in a lyophilized powder form with a purity of greater than 90% as determined by SDS-PAGE .

  • Storage and Handling: It should be stored at -20°C or -80°C upon receipt. Repeated freezing and thawing are not recommended .

Genomic Context of Bacillus subtilis

Bacillus subtilis has a well-characterized genome with a length of approximately 4.2 million base pairs, containing over 4,000 coding genes . The genome includes genes involved in various metabolic pathways, such as amino acid biosynthesis and carbon metabolism, which are crucial for its survival and probiotic properties . While the specific role of yckC within this genomic context remains unclear, its study could contribute to a deeper understanding of B. subtilis biology.

References Creative BioMart. Recombinant Full Length Bacillus subtilis Uncharacterized protein yckC(yckC) Protein (P42401) (1-151aa), fused to N-terminal His tag, was expressed in E. coli. Kobayashi, K., et al. (2006). Functional analysis of 11 putative essential genes in Bacillus subtilis. Frontiers in Veterinary Science. Complete genome analysis of Bacillus subtilis derived from yaks and its probiotic characteristics. MyBioSource. Recombinant Bacillus subtilis Uncharacterized protein yhgB (yhgB). Öktem, A., et al. (2023). Enhancing bacterial fitness and recombinant enzyme yield by engineering the quality control protease HtrA of Bacillus subtilis. PeerJ. Review History Identification and subcellular localization analysis of membrane protein Ycf 1 in the microsporidian Nosema bombycis. ChemicalBook. Recombinant Bacillus subtilis Uncharacterized protein yckC (yckC).

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type if needed, and we will prioritize its implementation.
Synonyms
yckC; BSU03390; Uncharacterized protein YckC; ORF3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yckC
Target Protein Sequence
MNIYKPAGFWIRLGAALLDYIIVSVPLLLIYWLITGKDPNDSMFISLVVLLYSILLPMFW RGYLIGKRICGIRIVKKDGSQVSLLTMFLRVIVAGLVYCITFGLGLIASLILIAVREDKR TLHDLIAGTYVTYATPGEEELNADEEIRKSE
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant yckC protein?

The recombinant protein should be handled according to these guidelines:

Storage ParameterRecommendation
Long-term storage-20°C/-80°C, aliquoted to prevent repeated freeze-thaw cycles
Working storage4°C for up to one week
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Post-reconstitutionAdd glycerol to 5-50% final concentration for long-term storage

Centrifuge the vial briefly before opening to collect the lyophilized powder at the bottom. For optimal stability, avoid repeated freeze-thaw cycles as this significantly impacts protein integrity .

What are the recommended quality control procedures for recombinant yckC preparations?

Standard quality control measures include:

  • SDS-PAGE analysis: The preparation should show >90% purity by SDS-PAGE

  • Molecular weight verification: Expected size of approximately 17 kDa plus any tag size

  • Functional assessments: While specific activity assays are not established for this uncharacterized protein, structural integrity can be assessed by circular dichroism

  • Solubility testing: Verification of proper folding through assessment of aggregation profiles

  • Endotoxin testing: For applications involving cellular systems

What expression systems are most effective for producing recombinant yckC protein?

Based on available data, E. coli expression systems have been successfully used to produce recombinant yckC . The protein can be expressed as a full-length construct (amino acids 1-151) with an N-terminal His-tag to facilitate purification.

Implementation methodology:

  • Clone the yckC gene into a suitable expression vector (e.g., pET series)

  • Transform into an E. coli expression strain (BL21(DE3) or similar)

  • Induce expression with IPTG at optimal temperature (typically 18-37°C)

  • Harvest cells and purify using metal affinity chromatography

  • Consider membrane protein extraction protocols if solubility issues arise

What purification strategies yield the highest purity and activity for recombinant yckC?

For optimal purification results:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resin

  • Intermediate purification: Ion exchange chromatography based on the protein's theoretical pI

  • Polishing step: Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Buffer optimization: Consider detergent screening if the hydrophobic regions cause solubility issues

  • Quality assessment: Analyze purity by SDS-PAGE with target purity >90%

What are the challenges and solutions for working with membrane proteins like yckC?

Based on sequence analysis, yckC appears to be a membrane protein, which presents specific challenges:

ChallengeSolution Approach
Limited solubilityUse mild detergents (DDM, LDAO, or C12E8) for extraction
AggregationInclude glycerol (5-10%) in buffers to prevent aggregation
Conformational stabilityOptimize buffer conditions (pH, salt, additives)
Low expressionTest various promoters, expression temperatures, and host strains
Purification difficultiesConsider on-column detergent exchange during IMAC

What methodological approaches can identify potential interaction partners of yckC?

To characterize the protein interaction network of this uncharacterized protein:

  • Bacterial two-hybrid screening: Similar to approaches used for YukC in the Type VII secretion system (T7SSb) of B. subtilis, which revealed its interaction network

  • Pull-down assays: Using His-tagged yckC as bait to identify binding partners from B. subtilis lysates

  • Co-immunoprecipitation: With antibodies against yckC or its epitope tag

  • Crosslinking mass spectrometry: To identify both stable and transient interaction partners

  • Proximity labeling: Using BioID or APEX2 fusions to identify proteins in close proximity to yckC in vivo

The bacterial two-hybrid approach has proven particularly valuable for mapping protein interactions in B. subtilis secretion systems, as demonstrated with YukC, which interacts with multiple T7SSb components .

How can researchers determine if yckC is regulated by zinc, similar to other B. subtilis proteins?

Several B. subtilis proteins are regulated by zinc through the Zur repressor. To investigate if yckC is similarly regulated:

  • Growth in zinc-depleted media: Compare expression levels of yckC in regular versus zinc-depleted conditions

  • Promoter analysis: Examine the yckC promoter region for potential Zur binding sites, similar to those found in yciC, ycdH, and yciA genes

  • Reporter fusion construction: Create yckC promoter-lacZ fusions to quantitatively measure expression under varying zinc concentrations

  • Electrophoretic mobility shift assays (EMSA): Test if purified Zur protein binds to the yckC promoter region in vitro

  • Expression analysis in zur mutants: Compare yckC expression in wild-type versus zur mutant backgrounds

For reference, the Zur regulon in B. subtilis includes genes such as yciC, ycdHI-yceA, yciA, and yciB, which show significant derepression in zur mutant strains .

What experimental designs can determine if yckC plays a role in bacterial competition mechanisms?

B. subtilis engages in both intra- and inter-species bacterial competition through specialized systems like T7SSb . To investigate if yckC participates in these mechanisms:

  • Gene knockout studies: Generate yckC deletion mutants and assess their competitive fitness

  • Competition assays: Co-culture wild-type and yckC mutant B. subtilis with competitor bacteria (e.g., Lactococcus lactis) to observe effects on survival

  • Fluorescence microscopy: Use GFP-labeled strains to monitor competition dynamics over time, similar to methods used in T7SSb studies

  • Colony forming unit (CFU) quantification: Measure survival rates in competition experiments

  • Transcriptomics: Compare gene expression patterns between competition conditions with wild-type versus yckC mutant strains

For context, B. subtilis T7SSb mediates competition through secreted toxins, with strains carrying impaired T7SSb showing reduced competitive ability against prey cells .

How might researchers investigate the relationship between yckC and the Type VII secretion system in B. subtilis?

The T7SSb in B. subtilis plays a central role in bacterial competition . To explore potential connections between yckC and this system:

  • Protein-protein interaction studies: Test direct interactions between yckC and known T7SSb components (YukC, YukD, YukE, YukB, YueB) using bacterial two-hybrid or co-immunoprecipitation approaches

  • Structural biology: Compare the structure of yckC with known T7SSb components to identify structural similarities

  • Localization studies: Determine if yckC co-localizes with T7SSb components using fluorescent protein fusions

  • Functional complementation: Test if yckC can complement any T7SSb component mutations

  • Secretome analysis: Investigate if yckC affects the secretion profile of B. subtilis, particularly of T7SSb substrates

Research has shown that the T7SSb complex in B. subtilis has a network of interactions centered around the pseudokinase YukC, which contacts all other T7SSb components .

What bioinformatic approaches can predict functional domains and potential roles of yckC?

For comprehensive bioinformatic characterization:

  • Transmembrane topology prediction: Use algorithms like TMHMM, Phobius, or TOPCONS to predict membrane-spanning regions

  • Conserved domain analysis: Search for functional domains using InterPro, Pfam, and CDD databases

  • Evolutionary analysis: Conduct phylogenetic studies to identify conserved residues across species

  • Structure prediction: Apply AlphaFold2 or similar tools to generate 3D structural models

  • Genomic context analysis: Examine gene neighborhoods across Bacillus species to identify functional associations

How can researchers determine if yckC plays a role in stress response or spore formation in B. subtilis?

B. subtilis is known for its ability to form highly resistant endospores . To investigate yckC's potential involvement in these processes:

  • Sporulation efficiency assays: Compare sporulation rates between wild-type and yckC mutant strains

  • Stress resistance tests: Subject spores from wild-type and yckC mutant strains to various stresses (heat, radiation, chemicals) to assess differences in resistance

  • Gene expression analysis: Monitor yckC expression during the sporulation process using qRT-PCR or reporter fusions

  • Microscopy: Use electron microscopy to examine spore ultrastructure in yckC mutants

  • Complementation studies: Determine if expressing yckC in trans can restore normal sporulation in mutants

Studies on B. subtilis spores have demonstrated their extreme longevity and resistance to environmental stresses, with viable spores recovered after years of dormancy .

What methodologies are most appropriate for investigating the structure-function relationship of the transmembrane domains in yckC?

To characterize the transmembrane regions of yckC:

  • Cysteine scanning mutagenesis: Systematically replace residues with cysteine to probe structure and accessibility

  • Targeted deletions or substitutions: Create precise mutations in predicted transmembrane regions to assess functional impacts

  • Chimeric proteins: Exchange transmembrane domains with well-characterized membrane proteins to determine functional importance

  • Lipid interaction studies: Use fluorescence spectroscopy or other biophysical methods to characterize lipid interactions

  • Cryo-electron microscopy: For structural determination in a near-native environment

This approach has been valuable in characterizing other B. subtilis membrane proteins, such as YukC, where cysteine scanning revealed structural dynamics of its transmembrane domains .

How can researchers develop specific activity assays for an uncharacterized protein like yckC?

Developing functional assays for uncharacterized proteins requires multiple approaches:

  • Phenotypic profiling: Compare metabolic, growth, and stress response phenotypes between wild-type and yckC mutant strains under various conditions

  • Protein-lipid interactions: Test binding to various lipids using lipid overlay assays or liposome binding experiments

  • Ion transport assays: Investigate potential transporter function using liposomes or membrane vesicles

  • Enzymatic activity screening: Test for common enzymatic activities (hydrolase, transferase, etc.) with appropriate substrates

  • Interactome expansion: Identify functions of interaction partners to infer potential roles

How can multi-omics approaches be used to elucidate the function of yckC in the broader context of B. subtilis physiology?

Integration of multiple omics datasets can provide comprehensive insights:

  • Transcriptomics: Compare RNA-seq profiles between wild-type and yckC deletion strains under various conditions

  • Proteomics: Analyze changes in the proteome in response to yckC manipulation

  • Metabolomics: Identify metabolic pathways affected by yckC deletion

  • Interactomics: Map the protein interaction network of yckC

  • Integration analysis: Use computational approaches to integrate these datasets and identify enriched pathways

The table below outlines a systematic multi-omics investigation approach:

Omics LevelTechniqueExpected Outcome
GenomicsComparative genomics across Bacillus speciesConservation patterns and genomic context
TranscriptomicsRNA-seq of WT vs. ΔyckCDifferentially expressed genes and pathways
ProteomicsLC-MS/MS of membrane fractionsChanges in membrane proteome composition
MetabolomicsUntargeted metabolite profilingAltered metabolic pathways
InteractomicsAffinity purification-MSDirect and indirect protein interactions

What are the methodological considerations for analyzing yckC in the context of bacterial membrane organization and microdomains?

Membrane proteins often localize to specific microdomains. To investigate yckC's membrane organization:

  • Super-resolution microscopy: Techniques like STORM or PALM to visualize nano-scale distribution of fluorescently tagged yckC

  • Detergent resistance fractionation: Isolate detergent-resistant membrane fractions to determine if yckC localizes to lipid rafts

  • FRET analysis: Measure proximity to known microdomain markers

  • Flotillin co-localization: Determine association with bacterial flotillin homologs, which organize functional membrane microdomains in B. subtilis

  • Domain swapping experiments: Replace regions of yckC to identify sorting signals for specific membrane localization

These approaches would help position yckC within the complex membrane architecture of B. subtilis, similar to studies that have shown specialized membrane organization of other bacterial systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.