Recombinant Bacillus subtilis Uncharacterized protein ycnL (ycnL)

Shipped with Ice Packs
In Stock

Description

Introduction to ycnL Protein

The ycnL protein is encoded by the ycnL gene in Bacillus subtilis (strain 168), a well-studied Gram-positive bacterium widely used as a model organism. While the exact function of ycnL remains to be fully characterized, research suggests it plays a role in cellular processes related to copper metabolism. The ycnL gene is located on the B. subtilis chromosome in close proximity to, but transcribed in the opposite direction from, the ycnKJI operon, which is involved in copper uptake . Based on homology searches, the ycnL protein is predicted to function as a reductase or disulfide isomerase . This protein consists of 117 amino acids and has been assigned the UniProt identification number P94434 .

Gene Organization and Transcription

The ycnL gene is positioned immediately upstream of ycnK but is transcribed in the opposite direction . This divergent orientation creates an intergenic region that contains regulatory elements important for the expression of both genes. Northern blot and primer extension analyses have confirmed that ycnL is transcribed from its own promoter, separate from the ycnKJI operon . The transcription start site of the ycnL promoter has been determined through primer extension analysis, with predicted -35 (ATGATA) and -10 (TTGAAC) sequences separated by a 17-bp spacer, suggesting recognition by σA RNA polymerase .

Predicted Function

While the specific biochemical activities of ycnL remain uncharacterized, homology analysis suggests it functions as a reductase or disulfide isomerase . The presence of multiple cysteine residues in its sequence further supports a potential role in redox reactions. Given its genetic proximity to the ycnKJI operon, which is involved in copper uptake (with ycnJ specifically encoding a membrane protein for copper uptake), ycnL may participate in copper homeostasis mechanisms in B. subtilis . The protein's predicted transmembrane nature also aligns with a potential role in metal ion trafficking or processing at the cell membrane interface.

Copper-Dependent Regulation

Research has shown that the ycnL promoter is subject to regulatory mechanisms influenced by copper availability. Interestingly, unlike the adjacent ycnKJI operon, which is strongly induced under copper-limiting conditions, the ycnL promoter is "hardly induced by copper limitation" . This differential response to copper availability between ycnL and the ycnKJI operon suggests distinct roles in copper homeostasis, despite their genomic proximity.

Role of YcnK in ycnL Regulation

The YcnK protein, encoded by the first gene in the ycnKJI operon, functions as a copper-responsive transcriptional regulator of the DeoR family . DNA binding experiments have demonstrated that YcnK binds specifically to the ycnK-ycnL intergenic region, which contains a 16-bp direct repeat (CACATTTTCACATTTT) essential for high-affinity binding . Through this binding, YcnK represses the expression of both the ycnKJI operon and, to a lesser extent, the ycnL gene .

LacZ reporter analyses have confirmed this regulatory relationship, showing that disruption of ycnK results in a slight induction of the ycnL promoter . This regulatory mechanism appears to be modulated by copper availability, as copper chelation significantly inhibits YcnK's DNA binding ability, leading to derepression of its target genes . The weaker repression of ycnL compared to ycnKJI suggests a more complex regulatory network governing ycnL expression, potentially involving additional factors beyond YcnK.

Research Significance and Future Directions

The study of ycnL and its relationship with the ycnKJI operon provides valuable insights into bacterial copper homeostasis mechanisms. The divergent transcription of ycnL relative to ycnKJI, combined with their shared but differential regulation by YcnK, represents an interesting model for studying the coordination of gene expression in response to metal availability .

Future research directions may include:

  1. Biochemical characterization of ycnL's enzymatic activities to confirm its predicted reductase or disulfide isomerase function

  2. Investigation of protein-protein interactions between ycnL and components of copper transport systems

  3. Determination of the three-dimensional structure of ycnL to elucidate structure-function relationships

  4. Further exploration of the regulatory network governing ycnL expression, including potential additional regulators beyond YcnK

  5. Examination of ycnL's role in bacterial physiology under various environmental conditions, particularly under copper stress

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are flexible to accommodate specific requirements. Please indicate your preferred format during the order process, and we will strive to fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for precise delivery timelines.
Note: Our standard shipping procedure includes normal blue ice packs. If you require dry ice for shipment, please communicate this requirement in advance, as additional fees will apply.
Notes
Avoid repeated freezing and thawing. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard protocol includes a final glycerol concentration of 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms retain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize its implementation.
Synonyms
ycnL; BSU03970; Uncharacterized protein YcnL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ycnL
Target Protein Sequence
MKETPCPNCGKPLTGDMVRSSNVPCQFRCGHCRERLYEYKVSAPIMLVSLAAIVLLIYLL MLLRNAAGSVLPAVQHVPMAVFALVCAYPVFIVSERMIAKYVIQNGNIIYRGKRKGS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the ycnL gene and its protein product in Bacillus subtilis?

YcnL is an uncharacterized protein in Bacillus subtilis that belongs to the ycn operon, which includes other characterized proteins such as YcnJ and YcnK that are involved in copper homeostasis. While detailed functional characterization of YcnL is limited, contextual information suggests it may be related to metal ion metabolism based on its genomic location. The protein's function might be inferred from other members of the operon, such as YcnJ, which plays an important role in copper acquisition and shows significant upregulation under copper-limiting conditions . Research approaches should focus on determining expression patterns under various metal stress conditions and potential interactions with other proteins in the operon.

What expression systems are recommended for recombinant production of YcnL?

For recombinant production of YcnL, Escherichia coli remains the most widely used expression system due to its rapid growth, well-established genetic manipulation tools, and cost-effectiveness. Based on successful approaches with other B. subtilis proteins, the following methodological strategy is recommended:

  • Clone the ycnL gene into pET28a+ vector using NcoI and XhoI restriction sites

  • Transform the construct into an appropriate E. coli strain (BL21(DE3) is commonly used)

  • Optimize expression conditions using a multivariate approach to determine optimal parameters

A systematic experimental design approach similar to that used for pneumolysin expression would be beneficial, as it allows for evaluation of multiple variables simultaneously while minimizing the number of experiments required .

How can I optimize soluble expression of recombinant YcnL protein?

Optimizing soluble expression of recombinant YcnL requires systematic evaluation of multiple variables. Based on experimental design methodologies used for other recombinant proteins, the following parameters should be considered:

ParameterRecommended Range for Optimization
Induction optical density0.4-1.0
IPTG concentration0.1-1.0 mM
Expression temperature16-37°C
Yeast extract concentration0.5-1.5%
Tryptone concentration0.5-1.5%
Glucose concentration0-0.5%
Expression time4-16 hours

What analytical methods are most effective for confirming the identity and purity of recombinant YcnL?

For comprehensive characterization of recombinant YcnL, employ a multi-method approach:

  • SDS-PAGE and Western blotting: Assess protein size, purity, and identity using antibodies against the protein or an affinity tag

  • Mass spectrometry: Confirm protein identity through peptide mass fingerprinting or intact mass analysis

  • N-terminal sequencing: Verify the correct start of the protein and identify potential processing

  • Size exclusion chromatography: Determine oligomeric state and homogeneity

  • Dynamic light scattering: Evaluate polydispersity and aggregation state

When reporting purity, provide quantitative analysis using densitometry software to calculate percentage purity from SDS-PAGE gels. Aim for >90% homogeneity for structural studies and >75% for functional assays, similar to standards reported for other B. subtilis recombinant proteins .

How should I design experiments to investigate potential binding partners of YcnL?

Investigating protein-protein interactions for an uncharacterized protein like YcnL requires multiple complementary approaches:

  • Bacterial two-hybrid analysis: An in vivo approach that can detect direct protein interactions. Follow protocols similar to those used for other B. subtilis proteins, using M9-glucose minimal media plates containing 40.0 μg/mL 5-bromo-4-chloro-3-indolyl-β-D-galactopyranoside, 250.0 μM IPTG, and appropriate antibiotics .

  • Co-immunoprecipitation: Express YcnL with an affinity tag in B. subtilis, then use tag-specific antibodies to pull down YcnL along with interacting partners. Identify these partners through mass spectrometry.

  • Pull-down assays: Immobilize purified YcnL on a suitable matrix and incubate with B. subtilis cell lysate to capture interacting proteins.

  • Proximity-based labeling: Express YcnL fused to a biotin ligase (BioID) in B. subtilis to biotinylate proteins in close proximity, followed by streptavidin pull-down and mass spectrometry identification.

For meaningful results, include appropriate controls: a known protein-protein interaction pair as a positive control, and a non-interacting protein as a negative control. Since YcnL may be part of a metal homeostasis system like YcnJ, consider testing interactions with YcnK and CsoR, which are known regulators in copper homeostasis .

What approaches can I use to determine the potential function of YcnL?

For functional characterization of an uncharacterized protein like YcnL, employ a combination of computational predictions and experimental validations:

  • Computational analysis:

    • Sequence homology searches against characterized proteins

    • Structural modeling based on homologous proteins

    • Genomic context analysis (operon structure, adjacent genes)

    • Motif identification for potential functional domains

  • Experimental approaches:

    • Generate a ΔycnL knockout strain using PCR fusion products and analyze phenotypic changes

    • Complement the knockout with wild-type and mutated variants

    • Perform growth studies under various stress conditions (especially metal stresses)

    • Analyze metal content of wild-type vs. ΔycnL cells using ICP-MS

Given that YcnL is in the same operon as YcnJ, which is involved in copper acquisition, test the ΔycnL strain specifically under copper-limiting and copper-excess conditions, similar to approaches used for characterizing YcnJ . Measure intracellular copper content to determine if YcnL, like YcnJ, affects copper homeostasis.

How can I determine if YcnL possesses enzymatic activity?

To investigate potential enzymatic activity of YcnL, follow this systematic approach:

  • Structural analysis for clues: If YcnL belongs to a known enzyme family based on sequence or structural similarity, test the corresponding activities. For example, YisK in B. subtilis was found to possess oxaloacetate decarboxylase activity based on structural similarity to the fumarylacetoacetate hydrolase (FAH) superfamily .

  • Substrate screening: Test purified recombinant YcnL with a panel of potential substrates based on:

    • Metabolites related to copper metabolism

    • Common substrates for the enzyme family identified by homology

    • Metabolites affected in the ΔycnL strain

  • Activity assays: Design appropriate assays based on suspected activity:

    • Spectrophotometric assays for changes in substrate/product concentration

    • Coupled enzyme assays for detecting reaction products

    • Mass spectrometry to identify conversion of substrates to products

  • Kinetic characterization: If activity is detected, determine enzyme kinetics parameters:

ParameterMethod of Determination
KmSubstrate concentration series
KcatTime-course at saturating substrate
Optimal pHActivity assays at different pH values
Metal dependenceActivity with/without metal ions
InhibitorsActivity in presence of potential inhibitors
  • Validation through mutagenesis: Create catalytic site mutants based on structural or sequence analysis (similar to the YisK E148A, E150A variant that served as a catalytic dead control) .

How can I investigate the localization and spatial regulation of YcnL in Bacillus subtilis?

To investigate YcnL localization and spatial regulation, implement a multi-stage approach:

  • Fluorescent protein fusion constructs:

    • Create both N-terminal and C-terminal fusions of YcnL with fluorescent proteins like GFP

    • Express these constructs under native promoter control

    • Observe localization using fluorescence microscopy under different growth conditions

  • Immunolocalization:

    • Generate specific antibodies against YcnL

    • Perform immunofluorescence microscopy to visualize native YcnL

    • This approach avoids potential artifacts from fusion proteins

  • Subcellular fractionation:

    • Separate membrane, cytoplasmic, and cell wall fractions

    • Detect YcnL in each fraction using Western blotting

    • Quantify relative distribution between compartments

  • Site-directed mutagenesis to identify localization determinants:

    • Create variants with mutations in potential localization signals

    • Analyze changes in localization pattern, similar to the YisK E30A variant that showed diffuse localization while maintaining enzymatic activity

  • Co-localization studies:

    • Examine co-localization with proteins of known function, particularly those involved in copper metabolism

    • Use dual-color fluorescence microscopy with differently labeled proteins

When reporting localization results, include quantitative analysis of localization patterns across a population of cells and under different conditions, particularly those that might affect copper homeostasis.

What strategies can I use to study the transcriptional regulation of the ycnL gene?

To comprehensively investigate transcriptional regulation of ycnL, employ these research strategies:

  • Promoter mapping and characterization:

    • Identify the transcription start site using 5' RACE

    • Construct reporter fusions (ycnL promoter-lacZ/gfp) to monitor promoter activity

    • Create promoter truncations to identify key regulatory regions

  • Identification of regulatory proteins:

    • Perform electrophoretic mobility shift assays (EMSAs) with the ycnL promoter region and cell extracts

    • Use DNA affinity chromatography to isolate proteins binding to the promoter

    • Test known regulators in the ycn operon, particularly YcnK and CsoR, which regulate YcnJ

  • Regulation under different conditions:

    • Monitor expression using qRT-PCR under varying copper concentrations

    • Examine expression in media with different metal compositions

    • Test expression during different growth phases and stress conditions

  • Analysis in regulatory mutants:

    • Generate ΔycnK and ΔcsoR single and double mutants, as was done for studying ycnJ regulation

    • Measure ycnL expression in these backgrounds using qRT-PCR or reporter fusions

  • Chromatin immunoprecipitation (ChIP):

    • Perform ChIP with tagged versions of suspected regulators

    • Confirm direct binding to the ycnL promoter in vivo

Based on findings for YcnJ, which is regulated by both YcnK and CsoR in response to copper levels, hypothesize that YcnL might be subject to similar regulation, potentially with elevated expression under copper limitation .

How can I design a comprehensive experimental approach to resolve contradictory findings about YcnL function?

When facing contradictory findings about YcnL function, implement this systematic resolution strategy:

  • Standardize experimental conditions:

    • Create a detailed protocol with standardized media compositions, growth conditions, and strain backgrounds

    • Ensure all strains are freshly verified by PCR and sequencing

    • Use multiple biological and technical replicates (minimum n=3)

  • Validate reagents and controls:

    • Confirm antibody specificity using knockout controls

    • Verify recombinant protein identity by mass spectrometry

    • Include positive and negative controls in all experiments

  • Employ orthogonal methods:

    • Investigate the same function using multiple independent techniques

    • For example, if studying metal binding, use native gel shifts, isothermal titration calorimetry, and metal-dependent activity assays

  • Genetic approach:

    • Create point mutations in key residues rather than complete gene deletions

    • Complement knockout strains with both native and mutated versions

    • Create double/triple knockouts with related genes to uncover redundancy

  • Consider strain-specific differences:

    • Test in multiple B. subtilis strains (e.g., 168, ATCC 21332, NCIB 3610)

    • Document any strain-specific phenotypes in a comparative table

  • Apply statistical rigor:

    • Use appropriate statistical tests for data analysis

    • Consider using Design of Experiments (DoE) methodology to systematically explore parameter space

    • Report effect sizes and confidence intervals, not just p-values

When publishing, present both supporting and contradicting evidence transparently, along with potential explanations for discrepancies, similar to how researchers analyzed varying impacts of expression parameters on recombinant protein production .

What are the best strategies for creating and validating a ycnL knockout strain in Bacillus subtilis?

For creating and validating a ycnL knockout strain, follow this methodological roadmap:

  • Design and construction:

    • Design primers to amplify upstream and downstream flanking regions (~1000 bp each)

    • Fuse these regions with an appropriate antibiotic resistance cassette

    • Use the Expand long-template PCR system to create the fusion product

    • Transform the PCR product directly into B. subtilis (strain ATCC 21332 or other relevant strain)

  • Selection and verification:

    • Select transformants on appropriate antibiotic plates

    • Verify gene replacement by PCR using primers outside the homology region

    • Confirm by Sanger sequencing across the integration junctions

    • Verify absence of YcnL protein by Western blotting if antibodies are available

  • Phenotypic characterization:

    • Compare growth curves of wild-type and ΔycnL strains in standard and stress conditions

    • Test specifically for metal-related phenotypes, focusing on copper limitation similar to tests for ΔycnJ

    • Measure intracellular metal content using inductively coupled plasma mass spectrometry (ICP-MS)

  • Complementation:

    • Reintroduce the ycnL gene at an ectopic locus or on a plasmid

    • Verify restoration of wild-type phenotype

    • Include both native promoter and inducible promoter versions

  • Controls and considerations:

    • Create marker-only integration control to verify antibiotic cassette doesn't cause phenotypes

    • Check for polar effects on downstream genes by RT-PCR

    • In the case of ycnL, examine effects on other genes in the ycn operon

What statistical approaches should I use when analyzing experiments with recombinant YcnL?

For robust statistical analysis of experiments with recombinant YcnL, implement these approaches:

  • Experimental design phase:

    • Use factorial design methodology to efficiently explore multiple variables

    • For protein expression optimization, implement a fractional factorial design (2^8-4) to evaluate factors like induction OD, IPTG concentration, and expression temperature

    • Include center points to detect non-linear effects

    • Ensure proper randomization of experimental runs

  • Data analysis for optimization experiments:

    • Calculate main effects and interaction effects

    • Determine statistical significance using ANOVA

    • Create response surface models to identify optimal conditions

    • Apply similar analysis methods as shown in this table from pneumolysin expression studies:

VariableEffect on Cell Growthp-valueEffect on Activityp-valueEffect on Productivityp-value
Induction absorbance1.43<0.0001323.50.00160.330.2248
IPTG-0.420.0387-52.00.5422-0.190.4720
Expression temperature1.13<0.0001-340.80.0011-0.910.0041
Yeast extract0.860.000477.00.37060.230.3930
Tryptone0.670.0027268.20.00610.790.0095
Glucose-0.330.0920164.30.06850.370.1797
  • Analysis for comparative experiments:

    • Use appropriate statistical tests based on data type and distribution:

      • t-tests for simple two-group comparisons

      • ANOVA for multi-group comparisons followed by post-hoc tests

      • Non-parametric alternatives when normality cannot be assumed

    • Report effect sizes and confidence intervals, not just p-values

    • Include power analysis to justify sample sizes

  • Dealing with variability in biological systems:

    • Use a minimum of three biological replicates

    • Distinguish between technical and biological variability

    • Apply appropriate transformations for heteroscedastic data

    • Consider mixed-effects models for nested experimental designs

  • Presenting statistical results:

    • Clearly state all statistical methods in methods section

    • Provide raw data in supplementary materials when possible

    • Use appropriate graphical representations with error bars

    • Be transparent about outlier handling and exclusion criteria

What strategies should I employ for crystallization and structural determination of YcnL?

For successful crystallization and structural determination of YcnL:

  • Protein preparation:

    • Purify YcnL to >95% homogeneity using multiple chromatography steps

    • Verify monodispersity by dynamic light scattering

    • Test protein stability in various buffers and additives using differential scanning fluorimetry

    • If full-length protein proves challenging, consider creating truncated constructs based on domain predictions

  • Initial crystallization screening:

    • Employ sparse matrix screens at multiple protein concentrations (5-20 mg/mL)

    • Test multiple temperatures (4°C, 18°C)

    • Include screens with metal ions, especially copper, given the potential relationship with copper metabolism

    • Use both hanging-drop and sitting-drop vapor diffusion methods

  • Optimization strategies:

    • Fine-tune promising conditions by varying precipitant concentration, pH, and additives

    • Implement seeding techniques to improve crystal quality

    • Consider surface entropy reduction mutations if crystallization is problematic

    • Try co-crystallization with potential binding partners or substrates

  • Data collection and structure determination:

    • Collect diffraction data at a synchrotron facility

    • If phasing proves difficult, prepare selenomethionine-labeled protein for MAD/SAD phasing

    • Consider heavy atom derivatives if selenomethionine approach is unsuccessful

    • For metal-binding studies, collect data at the absorption edge of the relevant metal

  • Structure validation and analysis:

    • Validate the structure using MolProbity or similar tools

    • Compare with structures of related proteins (if YcnL is related to YcnJ, look for structural features related to copper binding)

    • Analyze potential active sites or binding pockets

    • Use the structure to design point mutations for functional studies

Learning from the structural characterization of YisK, which revealed its similarity to oxaloacetate decarboxylases , structural studies of YcnL may similarly provide crucial insights into its function.

How can I address problems with low yield or insoluble expression of recombinant YcnL?

When facing challenges with recombinant YcnL expression, implement this systematic troubleshooting approach:

  • Expression vector optimization:

    • Try different affinity tags (His6, GST, MBP) and tag positions (N or C-terminal)

    • Test different promoter strengths

    • Consider codon optimization for the expression host

    • Evaluate different signal sequences if periplasmic expression is desired

  • Host strain selection:

    • Test specialized E. coli strains like BL21(DE3)pLysS for toxic proteins

    • Use Rosetta strains if rare codons are present

    • Consider SHuffle strains for proteins with disulfide bonds

    • Evaluate B. subtilis itself as an expression host for its native protein

  • Culture conditions optimization based on factorial design:

    • Lower the expression temperature (16-20°C) to increase solubility

    • Reduce inducer concentration to slow expression rate

    • Add specific additives to the culture medium:

AdditiveConcentration RangePotential Benefit
Glycine betaine1-2.5 mMProtein stabilization
Sorbitol0.2-0.5 MOsmolyte for folding
Ethanol1-3%Stress response activation
Cu²⁺10-100 μMIf YcnL is a copper-binding protein
Glucose0.2-0.5%Metabolic regulation
  • Solubilization and refolding strategies:

    • If protein remains insoluble, develop a refolding protocol

    • Use mild detergents (0.1% Triton X-100) to increase solubility

    • Test fusion to solubility-enhancing proteins like MBP or SUMO

    • Consider on-column refolding techniques

  • Scale-up considerations:

    • Ensure adequate aeration (use baffled flasks for shake cultures)

    • Monitor and control pH during fermentation

    • Implement fed-batch strategies to achieve higher cell densities

Apply a design of experiment (DoE) approach similar to that used for pneumolysin expression , systematically testing these variables to maximize soluble YcnL yield while minimizing the number of experiments required.

What are the key considerations for ensuring reproducibility in YcnL research?

To ensure reproducibility in YcnL research, address these critical factors:

  • Standardization of materials:

    • Document complete strain information, including full genotype and source

    • Specify exact plasmid constructs with sequence verification

    • Use consistent media preparations with defined components

    • Include detailed buffer compositions with pH, temperature, and preparation methods

  • Experimental protocols:

    • Provide step-by-step protocols with timing information

    • Specify equipment models and settings

    • Include all quality control steps

    • Document any deviations from standard protocols

  • Data collection and analysis:

    • Use validated analytical methods

    • Include detailed information on instrument calibration

    • Specify software versions and analysis parameters

    • Provide raw data and analysis scripts when possible

  • Statistical considerations:

    • Determine sample size through power analysis before experiments

    • Define exclusion criteria a priori

    • Use appropriate statistical tests with justification

    • Report variability metrics consistently (standard deviation vs. standard error)

  • Validation experiments:

    • Include positive and negative controls in all experiments

    • Validate antibody specificity using knockout controls

    • Verify key findings using orthogonal methods

    • Consider independent replication of critical experiments

When publishing, follow the comprehensive reporting guidelines recommended for molecular biology research, similar to the detailed methodological descriptions seen in studies of other B. subtilis proteins . This level of detail enables other researchers to accurately reproduce and build upon your findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.