Recombinant Bacillus subtilis Uncharacterized protein yczC (yczC)

Shipped with Ice Packs
In Stock

Description

Recombinant Bacillus subtilis

Recombinant Bacillus subtilis endospores have been employed in vaccinations against anthrax and tetanus .

Construction of Recombinant Strains

B. subtilis strains used for immunizations were PY79, a standard prototrophic laboratory strain, and a strain isogenic to the 168 type strain . Three recombinant derivatives of PY79 were created (HT230, HT251, and HT266) that expressed a carboxy-terminal domain of C. perfringens, Cpa 247-370, as a fusion to glutathione- S-transferase (GST) . The GST-Cpa 247-370 fusion has been previously described; in this work, it was expressed in the vegetative cell (HT230; rrnO-gst-cpa 247-370), on the spore surface as a fusion to the spore coat protein CotB (HT251; cotB-gst-cpa), and on the spore surface fused to CotB together with expression in the vegetative cell (HT266; 247-370 rrnO-gst-cpa) . 247-370cotB-gst-cpa 247-370... rrnO-RBS-MCS, enabling vegetative gene expression at high levels . The cassette comprises the B. subtilis rrnO promoter, the sspA ribosome binding site and a multiple cloning site into which candidate open reading frames can be inserted . The plasmid also carries left and right flanking sequences of the amyE (amylase) gene that allows insertion of constructions into the chromosome of B. subtilis using the amyE gene and selection provided by a chloramphenicol resistance gene (cat) .

Enhancing Bacterial Fitness and Recombinant Enzyme Yield

The study aimed to explore the impact of proteolytically inactive HtrA on protein production using the major industrial cell factory B. subtilis as a model system . The results showed that proteolytically inactive HtrA enhances bacterial fitness and recombinant enzyme production, especially upon scale-up .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yczC; BSU02710; Uncharacterized protein YczC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yczC
Target Protein Sequence
MELAGFMLRACALLLDVIIAAAVILAAGFTFGDGSAGVIIVAILMLIVYPLLMPLTNWKG TLGKKIIGLQIVRDETYKKISFPQAIVRYLIAWVHVFSRLIYLTAAFTKKKQTVHDMAAK TIVLKAE
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bacillus subtilis Uncharacterized protein yczC?

Recombinant Bacillus subtilis Uncharacterized protein yczC is a full-length protein (127 amino acids) derived from the Gram-positive bacterium Bacillus subtilis . As indicated by its designation as "uncharacterized," the specific biological function of this protein has not been fully elucidated, though emerging research suggests potential roles in cellular processes . The recombinant form typically includes an affinity tag, such as a His-tag at the N-terminus, to facilitate purification and subsequent experimental applications . The protein is commonly expressed in E. coli expression systems for research purposes, providing researchers with material for structural and functional studies .

How is recombinant yczC protein typically stored and reconstituted for experimental use?

Recombinant yczC protein is typically supplied as a lyophilized powder that requires proper storage and reconstitution to maintain activity . For optimal stability, store the lyophilized protein at -20°C to -80°C upon receipt . When preparing the protein for experimental use, briefly centrifuge the vial before opening to bring contents to the bottom . Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . To prevent protein degradation during long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (typically 50%) and aliquot the solution before storing at -20°C to -80°C . Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity . Working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw damage .

What expression systems are most effective for producing recombinant yczC protein?

E. coli is the most commonly used expression system for recombinant production of Bacillus subtilis yczC protein due to its high yield, cost-effectiveness, and established protocols . When designing an expression strategy, researchers should consider codon optimization for E. coli, as differences in codon usage between B. subtilis and E. coli can affect expression efficiency. The choice of promoter is crucial; for high-level expression, T7 promoter-based systems (such as pET vectors) are frequently employed. Due to the hydrophobic nature of yczC, expressing the protein may present challenges related to toxicity, inclusion body formation, or membrane insertion in the host cells.

For expression, consider the following methodological approach:

  • Transform the expression vector into a suitable E. coli strain (BL21(DE3) or derivatives)

  • Optimize induction conditions (IPTG concentration, temperature, induction time)

  • Test various growth media formulations to maximize protein yield

  • Consider autoinduction media for gradual protein expression, which may improve solubility

  • Conduct small-scale expression tests before scaling up to determine optimal conditions

What purification strategies yield the highest purity of recombinant yczC protein?

Purification of His-tagged recombinant yczC protein typically involves immobilized metal affinity chromatography (IMAC) as the primary capture step, utilizing the affinity of the His-tag for metal ions like Ni²⁺ or Co²⁺ . Since yczC appears to have transmembrane regions, it requires special consideration during purification to maintain protein integrity and solubility.

A methodical purification protocol might include:

  • Cell lysis under conditions appropriate for membrane proteins:

    • Mechanical disruption (sonication, homogenization, or French press)

    • Inclusion of detergents (DDM, CHAPS, or Triton X-100) to solubilize membrane-associated proteins

  • IMAC purification:

    • Equilibration of Ni-NTA or similar resin with appropriate buffer

    • Application of clarified lysate

    • Washing with buffer containing low imidazole concentrations to reduce non-specific binding

    • Elution with buffer containing high imidazole concentrations

  • Secondary purification steps:

    • Size exclusion chromatography to remove aggregates and further purify the protein

    • Ion exchange chromatography if charge-based separation can improve purity

  • Quality assessment:

    • SDS-PAGE to confirm purity (target >90%)

    • Western blotting to verify identity

    • Mass spectrometry for definitive identification

How can I assess the quality and purity of expressed yczC protein?

Quality assessment of purified recombinant yczC protein should include multiple analytical techniques to ensure identity, purity, homogeneity, and integrity. Purity should be assessed using SDS-PAGE, with a target of greater than 90% purity as determined by densitometric analysis . For identity confirmation, Western blotting using anti-His antibodies or antibodies specific to yczC protein (if available) is recommended. Mass spectrometry provides the most definitive identification and can also reveal potential post-translational modifications or degradation products.

For functional integrity assessment, consider:

  • Circular dichroism (CD) spectroscopy to evaluate secondary structure

  • Thermal shift assays to assess protein stability

  • Dynamic light scattering (DLS) to evaluate homogeneity and detect aggregation

  • Limited proteolysis to probe for properly folded domains

The combination of these methods provides a comprehensive assessment of protein quality before proceeding to functional studies.

What experimental approaches can be used to investigate the function of uncharacterized yczC protein?

Investigating the function of an uncharacterized protein like yczC requires a multi-faceted approach combining computational and experimental methods. When designing experiments to elucidate yczC function, consider the following methodological framework:

  • Bioinformatic analysis:

    • Sequence homology searches to identify related proteins with known functions

    • Domain prediction to identify functional motifs

    • Structural modeling and comparative analysis with proteins of known function

    • Genomic context analysis to identify neighboring genes that might be functionally related

  • Expression profile analysis:

    • RT-qPCR to determine expression under various conditions

    • RNA-seq for genome-wide expression correlation analysis

    • Promoter analysis to identify regulatory elements

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Bacterial two-hybrid or yeast two-hybrid screens

    • Proximity labeling methods such as BioID or APEX

    • Pull-down assays with tagged yczC as bait

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 genome editing to create knockout strains

    • Antisense RNA for knockdown studies

    • Phenotypic characterization of mutants under various conditions

  • Localization studies:

    • Fluorescent protein fusions to determine subcellular localization

    • Immunofluorescence microscopy

    • Subcellular fractionation followed by Western blotting

A well-designed experimental approach should incorporate proper controls and follow the systematic methodology outlined in experimental design guidelines .

How should I design experiments to investigate if yczC is regulated by zinc, similar to yciC?

Based on the information that the Bacillus subtilis Zur protein regulates zinc homeostasis by repressing at least 10 genes including yciC , investigating whether yczC is similarly regulated requires a careful experimental design approach:

  • Transcriptional analysis under varying zinc conditions:

    • Culture B. subtilis in defined media with controlled zinc concentrations (zinc-depleted, normal, zinc-excess)

    • Perform RT-qPCR or RNA-seq to quantify yczC expression levels under these conditions

    • Include yciC as a positive control and a housekeeping gene as a negative control

  • Promoter analysis:

    • Identify the promoter region of yczC

    • Conduct bioinformatic analysis to search for Zur binding motifs

    • Create promoter-reporter fusions (e.g., with lacZ or fluorescent proteins)

    • Measure reporter activity under varying zinc conditions

  • Zur binding assays:

    • Perform electrophoretic mobility shift assays (EMSA) with purified Zur protein and the yczC promoter region

    • Conduct DNase I footprinting to identify specific binding sites

    • Use chromatin immunoprecipitation (ChIP) to confirm Zur binding in vivo

  • Genetic approaches:

    • Create zur knockout mutants and measure yczC expression

    • Complement zur mutants and observe restoration of regulation

    • Create point mutations in predicted Zur binding sites in the yczC promoter

A well-controlled experimental design should include appropriate positive and negative controls, technical and biological replicates, and statistical analysis of results . This approach allows for a comprehensive evaluation of zinc-dependent regulation of yczC.

What are the key considerations for designing assays to test membrane association of yczC protein?

Given the amino acid sequence of yczC containing hydrophobic regions suggestive of transmembrane domains , developing assays to test membrane association requires careful methodological consideration:

  • Membrane fractionation approaches:

    • Differential centrifugation to separate cellular compartments

    • Sucrose gradient ultracentrifugation for refined membrane separation

    • Western blot analysis of fractions using anti-His antibodies to detect recombinant yczC

    • Include known membrane and cytosolic proteins as controls

  • Membrane protein extraction methods:

    • Test multiple detergents (mild to strong) for optimal solubilization

    • Compare extraction efficiency with different buffers and conditions

    • Analyze partitioning behavior in aqueous versus detergent phases

  • Fluorescent protein fusion localization:

    • Create N- and C-terminal fusions with fluorescent proteins

    • Examine cellular localization using fluorescence microscopy

    • Use membrane-specific dyes as co-localization markers

  • Protease protection assays:

    • Treat intact cells or membrane vesicles with proteases

    • Analyze protection of domains that are shielded by the membrane

    • Compare with and without membrane permeabilization

  • Membrane topology mapping:

    • Cysteine scanning mutagenesis with membrane-impermeable thiol reagents

    • PEGylation accessibility assays

    • Epitope insertion followed by immunofluorescence in permeabilized vs. non-permeabilized cells

How can structural biology techniques be applied to yczC protein characterization?

Characterizing the structure of the uncharacterized yczC protein can provide valuable insights into its function. A methodical approach to structural biology of yczC would include:

  • Protein sample preparation optimization:

    • Test various buffer conditions, detergents (for membrane proteins), and additives

    • Assess protein stability and homogeneity using dynamic light scattering

    • Optimize protein concentration for specific structural techniques

  • X-ray crystallography approach:

    • Screen multiple crystallization conditions (sparse matrix approach)

    • Optimize promising conditions by varying pH, temperature, protein concentration

    • Consider lipidic cubic phase crystallization if membrane association is confirmed

    • Data collection and processing followed by molecular replacement or experimental phasing

  • NMR spectroscopy methods:

    • Prepare isotopically labeled protein (¹⁵N, ¹³C, ²H)

    • Collect 2D and 3D spectra for backbone and side-chain assignments

    • Determine secondary structure elements from chemical shift data

    • Calculate 3D structure from distance constraints

  • Cryo-electron microscopy:

    • Sample preparation optimization (grid type, buffer, concentration)

    • Single particle analysis for soluble constructs

    • Electron crystallography for 2D crystals

    • Data processing and 3D reconstruction

  • Small-angle X-ray scattering (SAXS):

    • Collect data at multiple protein concentrations

    • Generate low-resolution envelope models

    • Combine with computational models for hybrid approach

Each method has particular strengths and limitations, especially for potentially membrane-associated proteins like yczC. A comprehensive structural characterization often benefits from combining multiple complementary techniques and integrating computational approaches .

What strategies can be employed to investigate potential protein-protein interactions involving yczC?

Investigating protein-protein interactions (PPIs) involving the uncharacterized yczC protein requires a multi-faceted approach that considers its potential membrane association. A methodological framework includes:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express His-tagged yczC in B. subtilis or recombinant systems

    • Perform pull-down experiments under native conditions

    • Identify co-purifying proteins by mass spectrometry

    • Validate interactions with reciprocal pull-downs

  • Cross-linking mass spectrometry (XL-MS):

    • Treat cells expressing yczC with chemical cross-linkers

    • Digest cross-linked complexes and analyze by MS

    • Identify cross-linked peptides to map interaction interfaces

  • Bacterial two-hybrid system:

    • Create fusion constructs with yczC and split reporter domains

    • Screen against B. subtilis genomic library

    • Validate positive interactions with independent methods

  • Fluorescence-based interaction assays:

    • Förster Resonance Energy Transfer (FRET) between yczC and candidate interactors

    • Bimolecular Fluorescence Complementation (BiFC) for visualization of interactions in vivo

    • Fluorescence Cross-Correlation Spectroscopy (FCCS) for dynamic interaction studies

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • Immobilize purified yczC on sensor chips

    • Measure binding kinetics with potential interacting partners

    • Determine binding constants and thermodynamic parameters

  • Proximity-dependent methods:

    • BioID or APEX2 proximity labeling fused to yczC

    • Identify proximal proteins in the native cellular environment

    • Distinguish between direct interactions and co-localization

Each method has inherent strengths and limitations, particularly for potentially membrane-associated proteins. A robust study would employ multiple complementary techniques and include appropriate controls for specificity validation .

How can systems biology approaches be applied to understand the role of yczC in B. subtilis cellular networks?

Understanding the role of uncharacterized proteins like yczC in the broader context of cellular networks requires integrative systems biology approaches. A comprehensive methodological framework would include:

  • Multi-omics integration:

    • Transcriptomics: RNA-seq comparing wild-type and yczC mutant strains under various conditions

    • Proteomics: Quantitative proteomics to identify differentially expressed proteins

    • Metabolomics: Profiling metabolite changes associated with yczC mutation

    • Integration of datasets to identify correlated changes across multiple levels

  • Network analysis:

    • Construction of protein-protein interaction networks including yczC

    • Pathway enrichment analysis of affected genes/proteins

    • Identification of network modules containing yczC

    • Betweenness centrality and other topological analyses to predict functional importance

  • Comparative genomics:

    • Analysis of yczC conservation across bacterial species

    • Synteny analysis to identify conserved genomic neighborhoods

    • Correlation of presence/absence with specific phenotypes or ecological niches

  • Genome-scale models:

    • Integration of yczC into existing genome-scale metabolic models of B. subtilis

    • Flux balance analysis to predict metabolic effects of yczC perturbation

    • Model validation with experimental growth data

  • Phenotypic microarrays:

    • High-throughput phenotyping of yczC mutants across numerous conditions

    • Identification of condition-specific roles

    • Clustering of phenotypic profiles with other mutants to identify functional relationships

A rigorous systems biology investigation would employ multiple complementary approaches and integrate diverse data types to place yczC within the broader cellular context, potentially revealing unexpected functional connections and generating testable hypotheses about its biological role .

What are common challenges in expressing and purifying yczC, and how can they be addressed?

Expressing and purifying membrane-associated proteins like yczC presents several technical challenges. A methodological approach to addressing these issues includes:

  • Addressing poor expression:

    • Optimize codon usage for the expression host

    • Test different expression strains (BL21(DE3), C41(DE3), C43(DE3), or Rosetta for rare codons)

    • Evaluate different promoter systems (T7, tac, ara)

    • Reduce expression temperature (16-20°C) to slow protein synthesis

    • Use auto-induction media for gradual protein production

  • Resolving inclusion body formation:

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Fuse with solubility-enhancing tags (SUMO, MBP, TrxA)

    • Optimize induction conditions (lower IPTG concentration, lower temperature)

    • Develop refolding protocols if expression in inclusion bodies is unavoidable

  • Improving membrane protein solubilization:

    • Screen multiple detergents (DDM, LDAO, CHAPS, Triton X-100)

    • Test detergent-to-protein ratios and solubilization times

    • Consider native nanodiscs or styrene-maleic acid lipid particles (SMALPs)

    • Evaluate amphipols for maintaining stability after extraction

  • Enhancing purification yield and purity:

    • Optimize buffer conditions (pH, salt concentration, additives)

    • Include stabilizing agents (glycerol, specific lipids)

    • Consider two-step purification (IMAC followed by size exclusion)

    • Test different His-tag positions (N-terminal vs. C-terminal)

  • Addressing protein instability:

    • Identify and minimize proteolysis (add protease inhibitors)

    • Optimize storage conditions (buffer composition, temperature)

    • Consider removing flexible regions prone to degradation

A systematic approach to troubleshooting would involve testing multiple conditions in parallel, careful documentation of outcomes, and incremental optimization based on results .

How can researchers troubleshoot experimental issues when studying protein-protein interactions involving yczC?

Investigating protein-protein interactions (PPIs) involving membrane-associated proteins like yczC presents unique challenges. A systematic approach to troubleshooting includes:

  • Addressing false negatives in interaction studies:

    • Verify protein expression and stability

    • Consider tag interference with interactions; test alternative tag positions

    • Optimize buffer conditions to maintain native protein conformation

    • Evaluate crosslinking approaches to capture transient interactions

    • Test multiple complementary interaction methods

  • Reducing false positives:

    • Include appropriate negative controls (unrelated proteins, empty vectors)

    • Validate interactions using orthogonal methods

    • Optimize washing stringency in pull-down experiments

    • Consider detergent effects on non-specific hydrophobic interactions

    • Implement quantitative filtering using statistics on MS results

  • Resolving detergent compatibility issues:

    • Screen detergents compatible with both membrane extraction and interaction assays

    • Test detergent concentration effects on interaction stability

    • Consider detergent-free systems (nanodiscs, SMALPs) to maintain lipid environment

    • Evaluate the impact of specific lipids on interaction stability

  • Improving signal-to-noise ratio:

    • Optimize protein concentration and binding conditions

    • Reduce background binding with blocking agents

    • Implement more sensitive detection methods

    • Consider proximity-based approaches for weak interactions

  • Validating biological relevance:

    • Confirm interactions in the native system

    • Perform domain mapping to identify interaction interfaces

    • Generate and test interaction-deficient mutants

    • Correlate interaction data with functional assays

When designing experiments to study yczC interactions, researchers should carefully consider the membrane association potential of the protein and how this might affect experimental design and interpretation of results .

What methodological considerations are important when designing genetic manipulation experiments for yczC in B. subtilis?

Genetic manipulation of yczC in Bacillus subtilis requires careful experimental design to ensure efficient modification and proper phenotypic analysis. A methodological framework includes:

  • Gene knockout/knockdown strategies:

    • Design homologous recombination constructs with sufficient flanking regions (>500 bp)

    • Consider polar effects on downstream genes in operons

    • Implement CRISPR-Cas9 systems optimized for B. subtilis

    • Validate knockout by PCR, sequencing, and RT-PCR/Western blot

    • Create conditional mutants if complete knockout is lethal

  • Complementation and overexpression:

    • Use integration vectors for stable, single-copy expression

    • Consider native vs. inducible promoters based on experimental needs

    • Validate expression levels by RT-qPCR and Western blot

    • Test different integration loci (amyE, thrC) for position effects

    • Include proper controls (empty vector integration)

  • Tagged protein expression for functional studies:

    • Evaluate tag position (N- vs. C-terminal) based on protein topology

    • Consider tag size effects on protein function

    • Test multiple tag types (His, FLAG, GFP) for different applications

    • Validate functionality of tagged constructs

  • Phenotypic analysis design:

    • Test growth under various conditions (media, temperature, stress)

    • Include specific conditions relevant to potential functions

    • Design quantitative assays for relevant cellular processes

    • Consider high-throughput phenotypic profiling approaches

    • Compare phenotypes to related gene knockouts (e.g., yciC)

  • Data analysis and controls:

    • Include appropriate control strains (wild-type, empty vector)

    • Perform biological and technical replicates

    • Use appropriate statistical methods for data analysis

    • Consider complementary approaches to validate findings

A comprehensive genetic analysis would employ multiple strategies and include thorough validation to ensure that observed phenotypes are specifically attributed to yczC manipulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.