Recombinant Bacillus subtilis Uncharacterized protein ydaH (ydaH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are open to fulfilling specific format requests. Please indicate your desired format in the order notes, and we will strive to accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C is recommended. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please communicate your requirements, and we will prioritize developing the specified tag.
Synonyms
amj; ydaH; BSU04230; Lipid II flippase Amj
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
amj
Target Protein Sequence
MHVITTQVLFIFCFLLLIHSIETLAYATRLSGARVGFIASALSLFNVMVIVSRMSNMVQQ PFTGHLIDDAGKNALAIVGEQFRFLIFGSTVGTILGIILLPSFVALFSRAIIHLAGGGGS VFQVFRKGFSKQGFKNALSYLRLPSISYVKGFHMRLIPKRLFVINMLITSIYTIGVLSAL YAGLLAPERSTTAVMASGLINGIATMLLAIFVDPKVSVLADDVAKGKRSYIYLKWTSVTM VTSRVAGTLLAQLMFIPGAYYIAWLTKWF
Uniprot No.

Target Background

Function
This protein plays a role in peptidoglycan biosynthesis. It facilitates the transport of lipid-linked peptidoglycan precursors from the inner to the outer leaflet of the cytoplasmic membrane. Potentially, it acts as a defense mechanism against naturally occurring MurJ antagonists.
Database Links
Protein Families
Amj family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YdaH and what is its renamed designation in Bacillus subtilis?

YdaH has been renamed as Amj (Alternate to MurJ) based on its functional characterization. This protein is a polytopic membrane protein predicted to have six transmembrane segments and functions as a novel lipid II flippase in Bacillus subtilis. Unlike other known flippases, YdaH/Amj has no sequence similarity to MurJ or other previously characterized flippases, making it the founding member of a novel family of flippases . The protein is expressed under the control of the cell envelope stress-response transcription factor σM and plays a crucial role in cell wall biosynthesis when the canonical MurJ is inhibited or absent.

In which bacterial species is YdaH/Amj found?

YdaH/Amj is not broadly conserved but is present in the genomes of a subset of both gram-positive and gram-negative bacteria. The protein has been identified in various bacterial species including Bordetella pertussis, Burkholderia mallei, and Clostridium botulinum. The phylum with the largest number of sequenced genomes containing YdaH orthologs is the Firmicutes, which includes Bacillus subtilis . The distribution pattern suggests that YdaH may play specialized roles in cell wall biosynthesis pathways that have evolved in specific bacterial lineages.

What is the relationship between YdaH/Amj and MurJ in Bacillus subtilis?

YdaH/Amj and YtgP (renamed as MurJ_Bs) form a synthetic lethal pair in Bacillus subtilis. This means that while cells can survive the deletion of either gene individually, the simultaneous deletion of both genes is lethal. When MurJ_Bs is absent, the expression of amj increases, suggesting a compensatory mechanism. Both proteins can function as lipid II flippases, which are essential for cell wall biosynthesis. The functional redundancy between these proteins provides B. subtilis with a robust system for maintaining cell wall integrity under various stress conditions .

What methods can be used to express and purify recombinant YdaH/Amj protein?

For the expression and purification of recombinant YdaH/Amj protein, researchers should consider the following methodological approach:

  • Expression system selection: As YdaH is a membrane protein with six transmembrane segments, expression systems optimized for membrane proteins are recommended. E. coli strains such as C41(DE3) or C43(DE3), specifically designed for membrane protein expression, can be used with vectors containing inducible promoters (T7 or arabinose-inducible).

  • Construct design: Engineer a construct with a cleavable affinity tag (His6, FLAG, or Strep-tag) at either the N- or C-terminus, ensuring it doesn't interfere with protein folding or function. Include a TEV protease cleavage site for tag removal after purification.

  • Membrane extraction: After expression, cells should be lysed (French press or sonication), and membranes isolated through differential centrifugation. The membrane fraction can be solubilized using detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or lauryl maltose neopentyl glycol (LMNG).

  • Purification steps: Implement a multi-step purification approach using:

    • Affinity chromatography (Ni-NTA for His-tagged proteins)

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Ion exchange chromatography as a polishing step if needed

  • Quality control: Assess protein purity using SDS-PAGE, protein functionality through activity assays, and structural integrity via circular dichroism or thermal shift assays .

How can one design experiments to investigate the lipid II flippase activity of YdaH/Amj?

To investigate the lipid II flippase activity of YdaH/Amj, researchers should implement the following experimental approaches:

  • Complementation assays: Express YdaH/Amj in E. coli strains depleted of MurJ to determine if it can rescue the lethal phenotype, as demonstrated in previous studies where expression of YdaH supported growth in E. coli strains lacking MurJ .

  • In vivo flippase assays: Utilize the established method for measuring lipid II flippase activity in E. coli as described in the PNAS paper. This typically involves:

    • Expressing YdaH/Amj in appropriate bacterial strains

    • Quantifying the translocation of radiolabeled or fluorescently tagged lipid II analogs across the membrane

    • Comparing flipping rates with positive controls (known flippases) and negative controls

  • Reconstitution in proteoliposomes: For more controlled studies:

    • Purify recombinant YdaH/Amj protein

    • Reconstitute it into liposomes

    • Measure the translocation of labeled lipid II from the inner to outer leaflet

    • Use fluorescence-based assays or accessibility to exogenous enzymes to quantify flipping activity

  • Structural studies: Employ structural biology techniques such as cryo-EM or X-ray crystallography to understand the molecular mechanism of lipid II recognition and flipping.

  • Site-directed mutagenesis: Identify and modify conserved residues to determine their role in substrate recognition and transport activity .

What strategies can be employed to study YdaH/Amj regulation by the σM transcription factor?

To investigate the regulation of YdaH/Amj by the σM transcription factor, researchers should employ these methodological approaches:

  • Promoter analysis and reporter assays:

    • Construct transcriptional fusions between the amj promoter region and reporter genes (lacZ, gfp)

    • Measure promoter activity in wild-type and σM-deficient (ΔsigM) backgrounds

    • Analyze the effect of cell envelope stress inducers on promoter activity

    • Conduct β-galactosidase assays as described in the experimental procedures section of the PNAS paper

  • Chromatin immunoprecipitation (ChIP):

    • Use antibodies against σM to immunoprecipitate σM-bound DNA

    • Perform ChIP-seq or ChIP-qPCR to confirm direct binding of σM to the amj promoter

    • Identify the precise binding site through footprinting or EMSA assays

  • RNA analysis:

    • Quantify amj transcript levels using RT-qPCR in various genetic backgrounds (wild-type, ΔsigM)

    • Perform RNA-seq to study global transcriptional changes in response to cell envelope stress

    • Map transcription start sites using 5' RACE to confirm σM-dependent promoters

  • Stress response experiments:

    • Expose cells to various cell envelope stressors (antibiotics, detergents, etc.)

    • Monitor changes in amj expression using reporter strains

    • Compare the stress response profile with other known σM-regulated genes

How does YdaH/Amj structurally and functionally differ from canonical MurJ flippases?

YdaH/Amj represents a novel class of lipid II flippases that bears no sequence similarity to either the MOP superfamily (which includes MurJ) or any other known flippase families. This structural and functional differentiation can be investigated through:

  • Comparative structural analysis:

    • YdaH/Amj is predicted to have six transmembrane segments, whereas MurJ proteins typically contain 14 transmembrane domains

    • Structural determination through X-ray crystallography or cryo-EM would reveal the unique architectural features of YdaH/Amj

    • Computational modeling could predict substrate-binding sites and translocation pathways

  • Mechanistic differences:

    • MurJ operates through a rocker-switch mechanism for substrate translocation

    • YdaH/Amj likely employs a distinct mechanism given its different structural organization

    • Investigation of energy coupling (ATP-dependent or proton gradient-dependent) would further differentiate these flippases

  • Substrate specificity:

    • While both transport lipid II, they might differ in their affinity for variants of lipid II or other lipid-linked precursors

    • Competition assays with various substrates could reveal differences in specificity

The comparative analysis table below summarizes key differences:

FeatureYdaH/AmjMurJ
Protein familyNovel flippase familyMOP exporter superfamily
Transmembrane domainsPredicted 6Typically 14
Sequence conservationLimited to subset of bacteriaBroadly conserved
RegulationσM-dependent expressionConstitutive expression
FunctionAlternative lipid II flippasePrimary lipid II flippase

What is the evolutionary significance of having alternative lipid II flippases in certain bacterial species?

The presence of alternative lipid II flippases like YdaH/Amj in specific bacterial lineages raises important evolutionary questions that can be investigated through:

  • Comparative genomics approaches:

    • Phylogenetic analysis of YdaH/Amj distribution across bacterial phyla

    • Correlation with ecological niches and lifestyles of bacteria possessing both flippase systems

    • Analysis of selective pressures acting on amj and murJ genes

  • Functional advantages:

    • The redundancy in lipid II flippases likely provides resilience against inhibitors targeting the canonical pathway

    • Bacteria inhabiting challenging environments may benefit from backup systems for essential processes

    • The alternative pathway might operate more efficiently under specific stress conditions

  • Experimental evolution studies:

    • Laboratory evolution experiments with B. subtilis under selective pressures (as described in search result )

    • Tracking the adaptive mutations in both flippase systems

    • Testing for the emergence of compensatory mechanisms when one system is compromised

The evolutionary distribution of YdaH/Amj in diverse bacteria including pathogens like Bordetella pertussis, Burkholderia mallei, and Clostridium botulinum suggests it may play a role in virulence or adaptation to host environments .

How does the synthetic lethality between YdaH/Amj and MurJ_Bs inform our understanding of cell wall biosynthesis pathways?

The synthetic lethality between YdaH/Amj and MurJ_Bs provides valuable insights into the cell wall biosynthesis pathway and can be further investigated through:

  • Pathway redundancy analysis:

    • The lethality of the double deletion indicates that lipid II flipping is an essential process with two redundant systems in B. subtilis

    • This redundancy may represent an adaptive strategy to ensure the integrity of cell wall synthesis under various environmental conditions

  • Regulatory network mapping:

    • Investigation of how cells upregulate amj expression when MurJ_Bs is absent

    • Analysis of the σM regulon to understand the broader stress response network

    • Identification of additional factors that may influence the compensatory mechanisms

  • Bottleneck identification:

    • The synthetic lethality highlights lipid II flipping as a critical bottleneck in peptidoglycan biosynthesis

    • Quantification of lipid II accumulation in various mutant backgrounds can reveal kinetic parameters of both flippases

    • Metabolic flux analysis could determine the relative contributions of each flippase under different conditions

This synthetic lethality also suggests therapeutic potential, as targeting both flippase systems simultaneously could be an effective antibacterial strategy against organisms possessing both systems.

How should researchers design and analyze transposon sequencing (Tn-seq) experiments to identify synthetic lethal partners of YdaH/Amj?

For designing and analyzing transposon sequencing experiments to identify synthetic lethal partners of YdaH/Amj, researchers should follow this methodological framework:

  • Experimental design considerations:

    • Generate transposon libraries in both wild-type and ΔydaH/Δamj backgrounds

    • Ensure sufficient library complexity (>100,000 insertions) for comprehensive genome coverage

    • Include appropriate controls and biological replicates

    • Cultivate libraries under relevant conditions that might reveal condition-specific synthetic interactions

  • Sample preparation protocol:

    • Extract genomic DNA from transposon libraries after selection

    • Prepare sequencing libraries through amplification of transposon-genome junctions

    • Ensure even amplification to prevent PCR bias

    • Follow protocols similar to those referenced in the PNAS paper experimental procedures

  • Sequencing considerations:

    • Use high-throughput sequencing platforms with sufficient read depth (>10 million reads)

    • Aim for read lengths that allow unambiguous mapping to the genome

  • Data analysis pipeline:

    • Map sequencing reads to the reference genome

    • Identify transposon insertion sites and count reads per insertion

    • Calculate the frequency of insertions in each gene

    • Apply statistical models to identify genes with significantly reduced insertion frequencies in the ΔydaH/Δamj background compared to wild-type

  • Validation approach:

    • Confirm synthetic lethal interactions through targeted gene deletions

    • Construct double mutants using inducible expression systems

    • Perform complementation assays to verify specificity

    • Use fitness assays to quantify the strength of genetic interactions 4

What experimental design considerations are important when studying the role of YdaH/Amj in antibiotic resistance?

When investigating the role of YdaH/Amj in antibiotic resistance, researchers should consider the following experimental design elements:

  • Strain construction strategy:

    • Generate precise gene deletions (ΔydaH/Δamj) and complementation strains

    • Create strains with controlled expression levels using inducible promoters

    • Develop reporter strains for monitoring ydaH/amj expression in real-time

    • Consider constructing strains with mutations in related pathways (e.g., cell wall synthesis genes)

  • Antibiotic susceptibility testing framework:

    • Determine minimum inhibitory concentrations (MICs) using standardized methods

    • Perform time-kill assays to assess the kinetics of antibiotic action

    • Conduct population analysis profiles to identify heteroresistant subpopulations

    • Use checkerboard assays to identify synergistic antibiotic combinations

  • Stress response analysis:

    • Monitor σM activity using reporter constructs under various antibiotic challenges

    • Measure ydaH/amj expression levels in response to different classes of antibiotics

    • Examine cell morphology and cell wall integrity through microscopy

    • Assess peptidoglycan composition and cross-linking through biochemical analyses

  • Mixed methods experimental approach:

    • Combine quantitative (MIC determinations) and qualitative (microscopy) methods

    • Use both targeted approaches (specific gene expression) and global analyses (transcriptomics)

    • Apply appropriate statistical tests based on data distributions

    • Follow a sequential exploratory design where qualitative findings inform quantitative experiments4

How can contradictory results in YdaH/Amj research be analyzed and reconciled?

When faced with contradictory results in YdaH/Amj research, researchers should employ the following analytical framework:

  • Systematic comparison of experimental conditions:

    • Create a detailed comparison table of methodological differences between studies

    • Identify variations in strain backgrounds, growth conditions, and experimental protocols

    • Assess differences in reagents, equipment, and measurement techniques

    • Evaluate data analysis approaches and statistical methods employed

  • Replication strategy:

    • Reproduce key experiments using standardized protocols

    • Vary critical parameters systematically to identify condition-dependent effects

    • Include positive and negative controls to validate experimental systems

    • Perform experiments in multiple laboratories if possible

  • Integration of multiple data types:

    • Employ mixed methods approaches combining qualitative and quantitative data

    • Use triangulation of different experimental techniques to address the same question

    • Apply complementarity rational where one approach addresses weaknesses of another

    • Conduct meta-analysis of available data when sufficient studies exist4

  • Resolution framework for conflicting data:

    • Examine whether contradictions are due to biological variability or methodological differences

    • Consider whether results reflect different aspects of the same biological phenomenon

    • Develop testable hypotheses that could explain seemingly contradictory observations

    • Design critical experiments specifically aimed at resolving contradictions 4

What are the most effective approaches for studying the interaction between YdaH/Amj and the cell envelope stress response?

To effectively study the interaction between YdaH/Amj and the cell envelope stress response, researchers should employ these advanced approaches:

  • Global transcriptome analysis:

    • Perform RNA-seq to compare gene expression profiles between wild-type and ΔydaH/Δamj strains under various stress conditions

    • Use differential expression analysis to identify genes co-regulated with ydaH/amj

    • Apply network analysis to position YdaH/Amj within the broader stress response network

    • Complement with ChIP-seq of σM to identify the complete regulon and its dynamics during stress

  • Proteomics strategies:

    • Use quantitative proteomics (SILAC, TMT) to measure changes in protein abundance during stress

    • Apply protein-protein interaction techniques (BioID, AP-MS) to identify YdaH/Amj interaction partners

    • Employ phosphoproteomics to map stress-responsive signaling pathways

    • Analyze membrane proteome changes to understand the impact on cell envelope composition

  • Cell envelope composition analysis:

    • Characterize peptidoglycan structure using HPLC, mass spectrometry, and NMR

    • Analyze membrane lipid composition through lipidomics approaches

    • Measure teichoic acid composition and d-alanylation status

    • Examine phosphatidylethanolamine incorporation into the cell membrane

  • Microscopy-based approaches:

    • Use fluorescent D-amino acids to visualize peptidoglycan synthesis in real-time

    • Apply super-resolution microscopy to localize YdaH/Amj within the cell

    • Implement time-lapse microscopy to monitor morphological changes during stress

    • Utilize electron microscopy to examine ultrastructural changes in the cell envelope

How can researchers evaluate the potential of YdaH/Amj as a novel antibiotic target?

To evaluate YdaH/Amj as a potential novel antibiotic target, researchers should implement this comprehensive validation framework:

  • Essentiality assessment:

    • Determine the genetic context in which YdaH/Amj becomes essential (e.g., in the absence of MurJ_Bs)

    • Use conditional expression systems to quantify the impact of YdaH/Amj depletion on bacterial viability

    • Assess essentiality across diverse bacterial species of clinical relevance

    • Evaluate the role of YdaH/Amj during infection using in vivo models

  • Druggability analysis:

    • Conduct structural studies to identify potential binding pockets in YdaH/Amj

    • Develop high-throughput screening assays for inhibitor discovery

    • Perform in silico docking studies with virtual compound libraries

    • Assess the conservation of binding sites across bacterial species

  • Inhibitor development strategy:

    • Design screening cascades with primary and secondary assays

    • Implement orthogonal assays to confirm mechanism of action

    • Evaluate synergy with existing antibiotics, particularly those targeting cell wall synthesis

    • Assess activity against clinical isolates and resistant strains

  • Resistance development assessment:

    • Conduct laboratory evolution experiments to evaluate the frequency of resistance

    • Characterize resistance mechanisms through whole-genome sequencing

    • Determine cross-resistance profiles with other antibiotics

    • Model the impact of dual targeting of MurJ and YdaH/Amj on resistance development

What computational approaches can be used to predict the structure and function of YdaH/Amj?

For predicting the structure and function of YdaH/Amj, researchers should employ these computational approaches:

  • Sequence-based analysis:

    • Apply multiple sequence alignment to identify conserved residues across YdaH/Amj orthologs

    • Use profile hidden Markov models to detect distant homologs

    • Implement transmembrane topology prediction tools to confirm the six transmembrane segments

    • Conduct evolutionary analysis to identify functionally important residues under selective pressure

  • Structure prediction methods:

    • Utilize AlphaFold2 or RosettaFold for de novo structure prediction

    • Apply comparative modeling if structural homologs can be identified

    • Refine models using molecular dynamics simulations in a membrane environment

    • Validate predictions through experimental techniques such as cross-linking or mutagenesis

  • Function prediction approaches:

    • Perform molecular docking simulations with lipid II substrates

    • Use molecular dynamics to simulate substrate translocation mechanisms

    • Apply computational alanine scanning to identify critical residues for function

    • Model protein-protein interactions with potential partners in the cell wall synthesis machinery

  • Systems biology integration:

    • Incorporate YdaH/Amj into genome-scale metabolic models of B. subtilis

    • Simulate the impact of YdaH/Amj deletion or inhibition on cellular metabolism

    • Predict synthetic lethal interactions through flux balance analysis

    • Model the regulatory network controlling YdaH/Amj expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.