Recombinant Bacillus subtilis Uncharacterized protein yddB (yddB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yddB; BSU04910; Uncharacterized protein YddB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yddB
Target Protein Sequence
MLNKEIGSDKKEESFFRSAFQKLKRIERPEKDKQKVPRDRSKLIAVTLWSCVGSLLFICL LAVLLSINTRSQLNDMKDETNKPTNDDKQKISVTAAENFLSGFINEYMNVKNDQESIEKR MQSLESYMVKQEDNHFEDEERFNVDGLKGDRELKGYSLYNVKEGDKNSLFQYKVTYENLY PVEKEVEKEVKDGKKKKKVKEKVKTNEKYEKQMLLNIPVTNKGDSFAVSAVPYFTQIYDL KGDIAFKGKEETRDEYAGEKKESIESFLQNFFEKYASEKKEEMVYMMKKPEALEGNLLFG EVQSVKIFETKKGFEVFCAVRFKEKENDIPVNEKFSLEITENSGQFYVNKLKHQ
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is YddB and what is its predicted role in Bacillus subtilis?

YddB in Bacillus subtilis is an uncharacterized membrane protein with predicted structural similarity to TonB-Dependent Transporters (TBDTs). Based on homology with E. coli YddB, it likely functions as an outer membrane protein involved in transport processes. In E. coli, YddB has been detected in the outer membrane and in outer membrane vesicles across multiple studies . It shares structural features with FusA (ferredoxin uptake system protein A), suggesting a potential role in transport of specific substrates across the membrane. Unlike well-characterized proteins such as YmdB (a phosphodiesterase that regulates biofilm formation and other adaptive responses in B. subtilis), YddB's specific function remains to be fully elucidated .

What are the challenges in expressing and purifying recombinant YddB?

Recombinant expression of membrane proteins like YddB presents several challenges including proper folding, solubility, and maintaining stability during purification. For the E. coli homolog, researchers successfully employed a strategy involving detergent solubilization with DDM (n-Dodecyl β-D-maltoside) followed by exchange into βOG (Octyl β-D-glucopyranoside) for crystallographic studies . For B. subtilis YddB, similar membrane protein purification approaches would likely be necessary, with potential modifications to account for differences in protein characteristics. Genetic code expansion systems in B. subtilis provide an additional avenue for producing recombinant YddB with non-standard amino acids for specific analytical purposes .

How can genetic code expansion systems be utilized to study YddB structure-function relationships?

Genetic code expansion offers powerful tools for incorporating non-standard amino acids (nsAAs) into YddB to investigate its structure-function relationships. Recent advances in B. subtilis genetic code expansion have demonstrated the incorporation of up to 20 distinct nsAAs using three different families of genetic code expansion systems . For YddB research, this technology enables:

  • Site-specific incorporation of photocrosslinking nsAAs to capture transient protein-protein interactions with potential binding partners

  • Click-chemistry compatible nsAAs for fluorescent labeling and visualization of YddB localization

  • Translational titration to modulate YddB expression levels with precise control

The methodology involves genomic integration of aminoacyl-tRNA synthetase (AARAS) constructs that facilitate efficient incorporation at amber stop codons. Unlike in E. coli, B. subtilis shows efficient nsAA incorporation at amber stop codons in native genes, making this approach particularly suitable for studying proteins like YddB .

What experimental approaches can address potential contradictions in YddB localization and function between model organisms?

Addressing contradictory findings between YddB homologs in different organisms requires systematic comparative analysis. A recommended experimental framework includes:

  • Comparative genomic analysis: Examine the genetic context of yddB across species, particularly focusing on operon structures. In E. coli, YddB is encoded in an operon with the FusC homologue PqqL and is regulated by Fur in response to iron limitation .

  • Differential localization studies: Use fluorescently tagged YddB variants to determine subcellular localization in B. subtilis compared to E. coli. Cross-complementation experiments can reveal functional conservation.

  • Iron-dependent expression analysis: Since E. coli YddB shows iron-dependent regulation, quantitative PCR and reporter fusion assays should be conducted under varying iron concentrations in B. subtilis to determine if this regulation is conserved .

  • Construction of clean deletion mutants: Generate precise yddB deletion strains in B. subtilis using methods analogous to those employed for E. coli (λ Red recombinase system with subsequent FLP-mediated marker removal) .

  • Phenotypic profiling: Compare growth, biofilm formation, and stress responses between wildtype and ΔyddB strains under diverse conditions to identify physiological roles.

This multi-faceted approach can resolve contradictions between model organisms and establish a more unified understanding of YddB function across bacterial species.

How might YddB interact with the established regulatory networks for adaptive responses in B. subtilis?

While direct evidence for YddB's role in B. subtilis adaptive responses is limited, insights can be drawn from other regulatory proteins like YmdB, which affects expression of more than 800 genes involved in biofilm formation, motility, and sporulation . To investigate YddB's potential regulatory interactions:

  • Transcriptomic analysis: Compare RNA-seq profiles between wildtype and ΔyddB strains under various stress conditions to identify differentially expressed genes, particularly focusing on known adaptive response pathways.

  • Protein-protein interaction network mapping: Employ photocrosslinking nsAAs incorporated at strategic locations in YddB to capture interaction partners in vivo, followed by mass spectrometry identification .

  • Epistasis analysis: Construct double mutants with known regulatory factors (e.g., ΔyddB/ΔymdB, ΔyddB/ΔsinR) to assess genetic interactions and pathway hierarchies.

  • ChIP-seq analysis: If YddB plays a direct or indirect role in transcriptional regulation, chromatin immunoprecipitation sequencing can identify genomic binding sites.

These approaches would elucidate whether YddB functions within established regulatory networks or represents a novel pathway for adaptive responses in B. subtilis.

What is the optimal protocol for recombinant expression and purification of B. subtilis YddB?

Based on successful approaches with the E. coli homolog, a recommended protocol for recombinant expression and purification of B. subtilis YddB would include:

Expression System:

  • Construct: pET-based vector with C-terminal 10× histidine tag and TEV protease cleavage site

  • Host: E. coli C43(DE3) or similar strain optimized for membrane protein expression

  • Induction: 0.2 mM IPTG at reduced temperature (18-20°C) for 16-18 hours

Purification Protocol:

  • Cell lysis in buffer containing 50 mM Tris, 200 mM NaCl, pH 7.9 with protease inhibitors

  • Membrane fraction isolation via differential centrifugation

  • Solubilization in 1% DDM for 1-2 hours at 4°C

  • Ni-NTA affinity chromatography with step gradient elution (50-250 mM imidazole)

  • Size exclusion chromatography using Superdex 200 in buffer containing 0.03% DDM

  • Detergent exchange to 0.8% βOG for structural studies via rebinding to Ni-NTA

  • TEV protease treatment to remove the histidine tag

  • Final purification step to remove TEV protease and cleaved peptide

This protocol should yield purified YddB suitable for biochemical, biophysical, and structural analyses. Protein purity and integrity should be assessed via SDS-PAGE and Western blotting.

How can genetic code expansion be implemented to incorporate non-standard amino acids into B. subtilis YddB?

Implementation of genetic code expansion for YddB studies requires the following methodological approach:

System Setup:

  • Select appropriate amber (UAG) codon positions in the yddB gene sequence based on structural predictions and functional hypotheses

  • Generate a stable B. subtilis strain with genomically integrated aminoacyl-tRNA synthetase (AARAS) constructs for your nsAA of choice

  • Clone the modified yddB gene with amber stop codons at selected positions

Incorporation Protocol:

  • Transform B. subtilis with the modified yddB construct

  • Grow cultures in media supplemented with the appropriate nsAA at 1-10 mM concentration

  • For photocrosslinking nsAAs (e.g., p-benzoyl-L-phenylalanine), expose cells to UV light (365 nm, 15-30 minutes) to activate crosslinking

  • For click-chemistry compatible nsAAs (e.g., p-azido-L-phenylalanine), perform post-expression labeling with fluorophores or affinity tags containing alkyne groups

Validation Methods:

  • Western blotting to confirm full-length protein expression (indicating successful stop codon suppression)

  • Mass spectrometry to verify nsAA incorporation at the correct position

  • Functional assays to ensure the modified protein retains native activity

This approach enables precise manipulation of YddB structure and function through site-specific incorporation of nsAAs with unique chemical properties.

What methods are most effective for studying YddB-mediated transport activities?

Investigating potential transport functions of YddB requires specialized techniques for membrane proteins:

In Vivo Transport Assays:

  • Construct fluorescently labeled potential substrates based on analogy with FusA-ferredoxin system

  • Monitor uptake in wildtype versus ΔyddB strains using fluorescence microscopy or flow cytometry

  • Perform competition assays with unlabeled substrates to determine specificity

Liposome Reconstitution:

  • Purify YddB as described above

  • Reconstitute into proteoliposomes with defined lipid composition

  • Encapsulate fluorescent indicators sensitive to transported substrates

  • Monitor transport activity through changes in fluorescence over time

Electrophysiological Characterization:

  • Reconstitute purified YddB into planar lipid bilayers

  • Perform single-channel recordings to measure conductance and selectivity

  • Test effects of potential substrates on channel properties

Structure-Guided Mutagenesis:

  • Based on the crystal structure of E. coli YddB, identify key residues in the binding pocket

  • Generate point mutations of these residues in B. subtilis YddB

  • Assess impact on transport activity using the above assays

This comprehensive approach would establish whether YddB functions as a transporter and identify its substrate specificity and transport mechanism.

How do the structural features of B. subtilis YddB compare to its E. coli homolog?

While a crystal structure for B. subtilis YddB is not yet available, comparative analysis with the E. coli homolog provides valuable insights:

Sequence alignment between E. coli and B. subtilis YddB would reveal conservation of key functional residues, particularly those involved in substrate binding and transport. Homology modeling using the E. coli YddB structure (PDB available from structural studies) as a template would provide a working structural model for the B. subtilis protein prior to experimental structure determination .

What approaches can resolve contradictions in predicted versus experimental structures of YddB?

Addressing discrepancies between predicted and experimental structures requires a multi-method approach:

By integrating these approaches, researchers can reconcile contradictions and develop a more accurate structural model of YddB.

What is the relationship between YddB and iron uptake regulation in B. subtilis?

Based on evidence from E. coli, where YddB expression is regulated by iron limitation and the ferric uptake regulator (Fur), investigating the relationship between YddB and iron homeostasis in B. subtilis would involve:

  • Expression analysis under iron limitation:

    • Quantitative RT-PCR to measure yddB transcript levels under varying iron concentrations

    • Western blotting to assess YddB protein expression in response to iron chelators

    • Fluorescent reporter fusions to monitor yddB promoter activity in real-time

  • Regulatory network analysis:

    • ChIP-seq to determine if B. subtilis Fur binds to the yddB promoter region

    • Electrophoretic mobility shift assays (EMSA) to confirm direct interaction between Fur and the yddB promoter

    • DNase footprinting to identify precise Fur binding sites

  • Phenotypic characterization:

    • Growth comparisons between wildtype and ΔyddB strains under iron-limited conditions

    • Measurement of cellular iron content using inductively coupled plasma mass spectrometry (ICP-MS)

    • Testing sensitivity to various iron chelators

  • Transport studies with iron-containing substrates:

    • Radioactive iron uptake assays comparing wildtype and ΔyddB strains

    • Identification of potential iron-containing substrates based on structural analysis

These approaches would establish whether YddB's role in iron uptake regulation is conserved between E. coli and B. subtilis.

How can contradictory functional data for YddB be reconciled through systematic mutation analysis?

To address contradictory functional data and establish a clearer understanding of YddB function, a systematic mutational analysis approach is recommended:

  • Domain-focused mutagenesis:

    • Generate mutations in the predicted substrate binding pocket

    • Create variants with alterations in the plug domain to assess gating mechanisms

    • Mutate conserved residues at the periplasmic face to disrupt potential interactions with transport machinery

  • Alanine-scanning mutagenesis:

    • Systematically replace clusters of residues with alanine throughout the protein

    • Evaluate the impact on expression, localization, and function

    • Identify regions critical for specific activities

  • Chimeric protein construction:

    • Create chimeras between B. subtilis YddB and E. coli YddB

    • Swap domains to identify regions responsible for species-specific functions

    • Test chimeras for complementation of phenotypes in both organisms

  • Conditional mutant analysis:

    • Develop temperature-sensitive or chemically regulated YddB variants

    • Study the immediate effects of YddB inactivation to distinguish primary from secondary effects

    • Use rapid protein degradation systems to control YddB levels temporally

  • Suppressor mutation screening:

    • Identify spontaneous suppressors that restore function in YddB mutants

    • Sequence these suppressors to identify genetic interactions

    • Map the network of functional interactions through these genetic relationships

This comprehensive mutational approach would reconcile contradictory data by identifying the specific structural elements responsible for each observed function or phenotype.

How does YddB potentially interact with adaptive response networks in B. subtilis?

To investigate YddB's role in B. subtilis adaptive responses, researchers should consider its potential integration with known regulatory systems:

  • Comparative transcriptomics:

    • Perform RNA-seq comparing wildtype and ΔyddB strains under various stress conditions

    • Look for overlap with known adaptive response regulons, such as those controlled by YmdB, which affects expression of more than 800 genes including the SinR-repressed biofilm genes

    • Analyze temporal expression patterns during stress responses

  • Genetic interaction mapping:

    • Construct double mutants with key regulators (ΔyddB/ΔymdB, ΔyddB/ΔsinR, etc.)

    • Assess phenotypes for evidence of synergistic or suppressive interactions

    • Use synthetic genetic array analysis for genome-wide interaction screening

  • Protein interaction network:

    • Perform co-immunoprecipitation with tagged YddB to identify binding partners

    • Use bacterial two-hybrid screens to test direct interactions with regulatory proteins

    • Apply proximity-dependent biotinylation (BioID) to identify proteins in close proximity to YddB in vivo

  • Subcellular localization dynamics:

    • Track YddB localization during different growth phases and stress responses

    • Co-localize with known components of adaptive response pathways

    • Analyze changes in localization patterns in various mutant backgrounds

This integrated approach would reveal whether YddB functions within established adaptive response networks or represents a novel regulatory pathway in B. subtilis.

What methodological approaches can determine if YddB contributes to biofilm formation in B. subtilis?

Given that YmdB is known to be essential for biofilm formation in B. subtilis , investigating YddB's potential role in this process requires specialized biofilm assays:

  • Static biofilm formation assays:

    • Compare wildtype and ΔyddB strains in standard microtiter plate biofilm assays

    • Quantify biomass via crystal violet staining and spectrophotometric measurement

    • Evaluate structural integrity through confocal microscopy of fluorescently labeled cells

  • Flow cell biofilm analysis:

    • Grow biofilms under continuous flow conditions to mimic natural environments

    • Monitor biofilm development in real-time through time-lapse microscopy

    • Assess structural parameters (thickness, roughness, surface coverage) using COMSTAT analysis

  • Matrix production assessment:

    • Quantify exopolysaccharide and extracellular protein components

    • Use congo red and calcofluor white binding to assess matrix composition

    • Examine expression of matrix production genes (epsA-O and tapA-sipW-tasA operons) in ΔyddB background

  • Genetic interaction with biofilm regulators:

    • Test epistatic relationships with known biofilm regulators (SinR, SlrR, DegU)

    • Construct double mutants and assess their biofilm phenotypes

    • Use transcriptional reporters to monitor expression of biofilm genes in various genetic backgrounds

  • Complementation studies:

    • Reintroduce wildtype yddB under various promoters to confirm phenotype reversal

    • Test if YddB variants with mutations in key domains can restore biofilm formation

    • Determine if E. coli YddB can complement B. subtilis ΔyddB biofilm defects

These methodological approaches would conclusively determine whether YddB contributes to biofilm formation in B. subtilis and reveal its relationship to the known YmdB-dependent biofilm regulatory pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.