Recombinant Bacillus subtilis Uncharacterized protein yddD (yddD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. To request a specific tag type, please inform us in advance; we will prioritize fulfilling specified tag requests.
Synonyms
yddD; BSU04930; Uncharacterized protein YddD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-174
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yddD
Target Protein Sequence
MGRLVFNYRKAMREPKKIQQLTENYSLPFAVELIPAINYFIFVGLCFGFWYGVRMIFPHA FDNSYVIVIFGIPFFLTMLVTKIKPEGKNIYIYFFDFAKYYFFIKLPQKKYCNDRKIDLS NEKQIEFRKLVKVVDYSNETKNAYEGNTQEFAVNKNGRRVGVLPNKKQFDSYAK
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the yddD protein from Bacillus subtilis?

The yddD protein is an uncharacterized protein from Bacillus subtilis (strain 168) that consists of 174 amino acids. It is classified as a hypothetical protein with Evidence level 5, indicating no homology to any previously reported sequences . Despite being uncharacterized, it belongs to a cluster of genes (including yddC, yddF, ydcS, and others) that show strong functional partnerships based on network analysis, suggesting involvement in related cellular processes .

How does yddD relate to other proteins in Bacillus subtilis?

Network analysis indicates that yddD has strong predicted functional partnerships with several other proteins in B. subtilis, particularly:

Functional PartnerScoreDescription
yddC0.997Conserved hypothetical protein
yddF0.987Conserved hypothetical protein
ydcS0.985Conserved hypothetical protein
ydcT0.961Conserved hypothetical protein
ydcR0.960Putative replication protein involved in DNA transfer
yddG0.952Conserved hypothetical protein
yddA0.948Conserved hypothetical protein
These high confidence scores (>0.9) suggest that yddD likely functions within a network of proteins, potentially involved in DNA transfer processes given the connection to ydcR, which is associated with the integrative and conjugative element ICEBs1 .

What are the optimal conditions for recombinant expression of yddD protein?

Based on general principles of recombinant protein expression and experimental design approaches, the expression of yddD can be optimized through multivariate analysis. While specific conditions for yddD aren't detailed in the search results, successful recombinant protein expression typically requires consideration of:

  • Expression system selection (E. coli, yeast, or mammalian cells)

  • Growth media composition

  • Induction conditions (temperature, inducer concentration, time)

  • Codon optimization for the host organism
    For any recombinant protein, including yddD, experimental design methodologies that employ factorial designs can efficiently determine optimal culture conditions with fewer experiments . This approach allows researchers to identify statistically significant variables affecting expression levels by changing multiple variables simultaneously rather than the traditional univariate method .

What is the recommended protocol for reconstitution and storage of recombinant yddD protein?

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage, with 50% being the default recommendation
    Storage Conditions:

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage:

    • Liquid form: 6 months at -20°C/-80°C

    • Lyophilized form: 12 months at -20°C/-80°C
      Note: Repeated freezing and thawing is not recommended as it may affect protein stability and function .

How can factorial design approaches be applied to optimize functional assays for yddD?

Implementing factorial design for yddD functional studies would involve:

  • Identifying key variables that might affect yddD function (pH, temperature, cofactors, substrates)

  • Creating a fractional factorial design to efficiently test these variables

  • Statistical analysis to determine significant effects and optimal conditions
    This approach is more efficient than traditional one-variable-at-a-time methods as it:

  • Requires fewer experiments to gather comprehensive data

  • Allows estimation of statistically significant variables

  • Takes into account interactions between variables

  • Characterizes experimental error

  • Allows comparison of variable effects when variables are normalized
    For yddD specifically, a 2^(k-p) fractional factorial design could be employed, where k is the number of variables and p represents the fraction. For example, if investigating 8 variables, a 2^(8-4) design would reduce the required experiments from 256 (full factorial) to just 16, plus center point replicates .

What bioinformatic approaches can help predict potential functions of yddD?

Several bioinformatic approaches can provide insights into the potential functions of uncharacterized proteins like yddD:

  • Network Analysis: Expand on the existing STRING database information to identify additional functional partners and enriched pathways.

  • Structural Prediction: Use AlphaFold or similar tools to predict the 3D structure of yddD, which may reveal structural motifs associated with specific functions.

  • Gene Neighborhood Analysis: Examine the genomic context of yddD to identify potential operons or functionally related gene clusters.

  • Comparative Genomics: Analyze the presence/absence patterns of yddD homologs across bacterial species to infer evolutionary conservation and potential functional importance.

  • Gene Expression Correlation: Analyze transcriptomic data to identify conditions under which yddD is co-expressed with genes of known function.
    A comprehensive approach would integrate multiple methods to generate testable hypotheses about yddD function.

How might translation initiation site accessibility affect yddD expression levels?

Recent research on recombinant protein production indicates that the accessibility of translation initiation sites (modeled using mRNA base-unpairing across Boltzmann's ensemble) significantly impacts expression success . For yddD specifically:

  • The accessibility of the translation initiation site could be analyzed and optimized by examining the unpairing propensities of nucleotides around this region.

  • Synonymous codon changes in the first nine codons of the yddD mRNA sequence could be introduced to improve accessibility without altering the amino acid sequence.

  • Computational models suggest that higher accessibility leads to higher protein production but may slow cell growth due to protein cost .
    This approach represents a low-cost technique to tune yddD expression through minimal gene engineering. Optimal opening energy values of approximately 12 kcal/mol or less are associated with successful translation initiation .

What experimental approaches could determine if yddD is involved in the ICEBs1 transfer system?

Given the strong functional partnership between yddD and ydcR (a probable DNA relaxase involved in ICEBs1 transfer) , the following experimental approaches could determine if yddD plays a role in this system:

  • Gene Knockout and Complementation:

    • Create a yddD deletion strain of B. subtilis

    • Measure ICEBs1 transfer frequency compared to wild-type

    • Complement with yddD expression constructs to confirm phenotype restoration

  • Protein-Protein Interaction Studies:

    • Perform co-immunoprecipitation experiments with tagged yddD and ydcR

    • Use bacterial two-hybrid systems to confirm direct interactions

    • Apply proximity labeling techniques (BioID or APEX) to identify proteins physically close to yddD during ICEBs1 transfer

  • Localization Studies:

    • Create fluorescently tagged yddD to track its subcellular localization during conjugation

    • Determine if yddD colocalizes with other ICEBs1 transfer apparatus components

  • DNA Binding Assays:

    • Test whether purified yddD binds to ICEBs1 DNA, particularly around the origin of transfer

How can stochastic simulation models predict the impact of yddD overexpression on cellular growth?

Stochastic simulation models, similar to those described for recombinant protein production , could be adapted to predict the impact of yddD overexpression:

  • Model Setup:

    • Bin opening energies of yddD mRNA constructs between 2-32 kcal/mol

    • Generate technical replicates with slight variations in opening energy

    • Model mRNA copies generated from plasmid DNA (30-60 copies)

    • Set translation probability based on opening energy thresholds

    • Incorporate mRNA decay after ~10 translation events

  • Protein Toxicity Simulation:

    • Set protein threshold at approximately 1,000,000 copies (compared to endogenous levels of <10,000)

    • Model sporadic cell death when protein exceeds threshold

    • Balance growth and death probabilities to maintain viable population

  • Simulation Parameters:

    • Initialize with 100 cells

    • Run until termination (10,000 iterations or when cell count reaches zero)

    • Record total protein production and cell count at endpoints

    • Repeat simulation with different random seeds to generate biological replicates
      This modeling approach would help predict how different yddD expression levels might impact cell growth and protein yield, informing experimental design before laboratory resources are committed .

What controls should be included when studying yddD function in B. subtilis?

To rigorously study yddD function, researchers should include several critical controls:

  • Genetic Controls:

    • Wild-type B. subtilis strain 168 (positive control for normal yddD expression)

    • yddD deletion mutant (negative control)

    • Complementation strain (yddD deletion with plasmid-expressed yddD)

    • Overexpression strain (wild-type with additional yddD copies)

    • Related gene deletions (yddC, yddF, etc.) to test for functional redundancy

  • Protein Expression Controls:

    • Empty vector control for recombinant expression studies

    • Non-functional yddD variant (site-directed mutant) to confirm specificity

    • Tagged vs. untagged protein comparisons to ensure tag doesn't interfere with function

  • Experimental Conditions:

    • Test function under various growth conditions (minimal vs. rich media)

    • Stress conditions to identify potential induction of yddD function

    • Growth phase comparisons (exponential vs. stationary)

How can researchers address the challenge of studying an uncharacterized protein with no known homologs?

Studying proteins like yddD that lack homology to known sequences requires a systematic approach:

  • De Novo Functional Discovery:

    • Phenotypic screening of knockout strains under diverse conditions

    • Metabolomic profiling to identify altered metabolic pathways

    • Transcriptomic analysis to identify genes with altered expression

    • Suppressor mutation screening to identify genetic interactions

  • Structural Analysis Approach:

    • Determine 3D structure through X-ray crystallography, NMR, or cryo-EM

    • Identify structural motifs that might suggest function

    • Perform structure-guided mutagenesis to test functional hypotheses

  • Proximity-Based Methods:

    • Apply proximity labeling techniques to identify interacting partners

    • Use chemical crosslinking followed by mass spectrometry

    • Employ split reporter systems (e.g., split GFP) to confirm proximity in vivo

  • Evolutionary Approach:

    • Search for distant homologs using sensitive methods like HHpred

    • Analyze phylogenetic distribution patterns across bacterial species

    • Identify co-evolving genes that might share function
      This multi-faceted approach increases the likelihood of functional discovery for proteins without obvious homologs.

How should researchers interpret contradictory results in yddD functional studies?

When facing contradictory results in functional studies of uncharacterized proteins like yddD:

  • Reconciliation Strategies:

    • Examine methodological differences between experiments

    • Consider strain background variations

    • Evaluate growth conditions and media composition

    • Assess protein expression levels and activity states

  • Statistical Approach:

    • Apply robust statistical methods from experimental design literature

    • Consider analysis of non-normal data and complex aliasing

    • Implement analysis of variance (ANOVA) with random effects

    • Use expected mean squares analysis to determine appropriate sample sizes

  • Integrated Analysis:

    • Combine results from multiple experimental approaches

    • Weight evidence based on methodological rigor

    • Look for conditional effects that might explain contradictions

    • Consider partial or context-dependent functions

  • Meta-Analysis:

    • Systematically review all available data

    • Identify patterns across different experimental systems

    • Apply Bayesian methods to update probability of functional hypotheses

What statistical approaches are most appropriate for analyzing the effects of yddD mutations on cellular phenotypes?

For analyzing yddD mutation effects on phenotypes, several statistical approaches are appropriate:

  • For Single-Variable Phenotypes:

    • One-way and two-way ANOVA with random effects to account for batch variation

    • t-tests with appropriate corrections for multiple comparisons

    • Non-parametric alternatives (Mann-Whitney U test) for non-normal distributions

  • For Multi-Variable Phenotypes:

    • Multivariate ANOVA (MANOVA) to analyze multiple dependent variables

    • Principal Component Analysis (PCA) to reduce dimensionality

    • Cluster analysis to identify groups of similar mutants

  • For Time-Course Experiments:

    • Repeated measures ANOVA

    • Mixed-effects models to account for within-subject correlations

    • Time series analysis for continuous measurements

  • For Complex Phenotypes:

    • Response surface methodology for related factors

    • Split-plot designs for analyzing factorial effects with constraints

    • Minimum aberration designs for efficiently testing multiple factors
      Each approach should be selected based on the specific experimental design, with careful consideration of statistical power, sample independence, and distribution assumptions.

What emerging technologies could accelerate functional characterization of yddD?

Several cutting-edge technologies could significantly advance yddD characterization:

  • CRISPR-Based Technologies:

    • CRISPRi for tunable repression of yddD expression

    • CRISPRa for targeted upregulation

    • Base editors for precise nucleotide changes without double-strand breaks

    • CRISPR screens to identify genetic interactions

  • Advanced Imaging:

    • Super-resolution microscopy to track yddD localization at nanometer scale

    • Live-cell imaging with photoactivatable fluorescent proteins

    • Single-molecule tracking to observe dynamics in real-time

    • Correlative light and electron microscopy (CLEM) for structural context

  • High-Throughput Approaches:

    • Deep mutational scanning to assess function of thousands of variants

    • Microfluidics-based single-cell analysis

    • Automated phenotyping in diverse environmental conditions

  • Computational Methods:

    • Artificial intelligence for structure prediction and function inference

    • Molecular dynamics simulations to model protein behavior

    • Network-based function prediction algorithms

    • Quantum computing approaches for complex modeling

How might understanding yddD function contribute to broader knowledge of Bacillus subtilis biology?

Understanding yddD function could impact several areas of B. subtilis biology:

  • Horizontal Gene Transfer:

    • If linked to ICEBs1 transfer, yddD could provide insights into evolution and adaptation

    • Might reveal novel mechanisms of DNA transfer between bacteria

    • Could identify targets to control gene spread in microbial communities

  • Cellular Physiology:

    • May uncover previously unknown metabolic or regulatory pathways

    • Could reveal stress response mechanisms unique to soil bacteria

    • Might identify novel cell division or differentiation processes

  • Biotechnological Applications:

    • Could improve B. subtilis as a host for recombinant protein production

    • Might identify novel enzymes with industrial applications

    • Could enhance biosynthetic pathway engineering

  • Comparative Microbiology:

    • Would provide insights into functions of uncharacterized proteins in other species

    • Could reveal evolutionary adaptation strategies in soil bacteria

    • Might identify conserved but previously overlooked biological processes Understanding this uncharacterized protein would contribute to closing knowledge gaps in bacterial genomics, where a significant percentage of genes remain functionally uncharacterized.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.