Recombinant Bacillus subtilis Uncharacterized protein yddM (yddM)

Shipped with Ice Packs
In Stock

Description

Introduction

The protein YddM is an uncharacterized protein from Bacillus subtilis, a Gram-positive bacterium commonly found in soil and the gastrointestinal tract of ruminants and humans . Due to its uncharacterized nature, information regarding its function is limited. Studies employ recombinant versions of YddM to investigate its properties and potential roles within Bacillus subtilis .

Basic Information

CharacteristicDescription
Source OrganismBacillus subtilis
Protein TypeUncharacterized membrane protein
TagHis-Tag (N-terminal)
SizeFull Length (1-179aa)
Expression SystemE. coli
Uniprot No.P96650

YidC Substrates

YidC, a protein crucial for membrane protein biogenesis in bacteria, has been investigated in Bacillus subtilis to identify its substrates . Research leveraged the translation arrest sequence of MifM to pinpoint membrane proteins dependent on SpoIIIJ, the YidC homolog in B. subtilis . This approach identified eight membrane proteins as potential SpoIIIJ substrates, enhancing our understanding of how membrane proteins are sorted and inserted in Gram-positive bacteria .

MinD Studies

The Min system in bacteria, particularly MinD, plays a role in cell division. Studies involving Bacillus subtilis MinD have used recombinant proteins to explore its function and regulation . For instance, ATPase activity assays with purified, recombinant MinD mutants provided insights into the importance of membrane binding for ATP hydrolysis . Mutants of MinD, such as G12V and K16A, lead to increased cell length and minicell production, which is expected in cells containing dysfunctional Min proteins .

Interactions with DnaA

Research has also explored the interactions between the DNA replication initiator DnaA and other proteins in Bacillus subtilis . While YddM is not directly mentioned, understanding protein-protein interactions is crucial for elucidating cellular mechanisms, and this type of research could potentially extend to YddM in the future .

HtrA Protease

The quality control protease HtrA of Bacillus subtilis is also a target for improving bacterial fitness and recombinant enzyme yield . Although YddM is not directly related to HtrA, modifying proteases like HtrA can have broad effects on protein production and stability within the cell .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yddM; BSU05030; Uncharacterized protein YddM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yddM
Target Protein Sequence
MGENMFKKEKVTEYIWTILIPTIITFIISWVGSYYNGTSTVSIGQPTKVSGQYITPINIS PYHDIKELRITFPQKLDVKQISSNEPINVKSDKNNIGVESNSTFEIAKIVENNSVQLLIT TQKKLNDKEIRIDKNGNNISVNYESQIVNPAKKQLINLIITSSIYFIMLNILALIMNKRW DKYYAKMKNEIKEFEDNAKDLDKKSKKKSEELSELRKTLNQAFEETDRIKYHEKKKQILL LAKLNDYKKELTFWRNTIRKVLYELPDGDKKADKLIGTVTSSLKTYGTVEKNEHDYESLK VAAALLNDSDKRS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant YddM protein?

E. coli expression systems have been demonstrated to successfully produce recombinant YddM protein. The most common approach involves expressing the full-length protein (amino acids 1-313) with an N-terminal His-tag for purification purposes . The protein can be purified to greater than 90% purity as determined by SDS-PAGE analysis. For optimal expression, researchers should consider:

  • Using BL21(DE3) or similar E. coli strains optimized for protein expression

  • Induction at OD600 of 0.6-0.8 with appropriate IPTG concentration

  • Post-induction growth at lower temperatures (16-25°C) to enhance proper folding

  • Utilizing lysis buffers containing protease inhibitors to prevent degradation

This method allows for effective isolation of the protein for subsequent structural and functional analyses.

How should recombinant YddM protein be stored and handled for maximum stability?

Recombinant YddM protein should be stored as follows for optimal stability:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution, aliquot the protein to avoid repeated freeze-thaw cycles

  • For short-term use, working aliquots can be stored at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is recommended) and store at -20°C/-80°C

For reconstitution:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 as storage buffer

Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided.

What is the putative role of YddM as a transcription factor in Bacillus subtilis?

YddM has been computationally predicted to function as a transcription factor in Bacillus subtilis . While its precise regulatory targets remain to be fully characterized, it belongs to a category of uncharacterized transcription factors identified through systematic discovery approaches.

Transcription factors like YddM may play roles in regulating various cellular processes in B. subtilis, potentially similar to the extensively studied LutR regulator. For context, LutR has been shown to regulate 65 transcriptional units corresponding to 23 monocistronic units and 42 operons . These regulated processes include:

  • Degradative enzyme production

  • Antibiotic production and resistance

  • Carbohydrate utilization and transport

  • Nitrogen metabolism

  • Phosphate uptake

  • Fatty acid and phospholipid biosynthesis

  • Protein synthesis and translocation

  • Cell-wall metabolism

  • Energy production

  • Mobile genetic element transfer

  • Phage-related gene induction

  • Sporulation regulation

  • Biofilm formation

Research examining the specific DNA-binding motifs and target genes of YddM will be crucial to establishing its regulatory network and physiological role in B. subtilis.

How does YddM compare structurally with other characterized bacterial transcription factors?

While the complete three-dimensional structure of YddM has not yet been experimentally determined, comparative analysis with other bacterial transcription factors can provide insights:

YddM appears to belong to a distinct class of transcription factors similar to others identified in systematic discovery studies such as YbiH, YbaQ, and YeiE . Computational structural prediction approaches similar to those used for YdcI, YeiE, and YiaJ can be applied to model YddM structure using the SWISS-MODEL pipeline, which would:

  • Identify suitable structural templates from proteins with similar sequence identity

  • Predict the oligomeric state based on interface conservation scores

  • Generate a preliminary structural model that could inform DNA-binding mechanisms

Given the uniqueness of some bacterial membrane proteins like YeeE, which displays an unprecedented hourglass fold , YddM may potentially possess novel structural features that facilitate its function as a transcription factor. Experimental structure determination through X-ray crystallography or cryo-EM would be necessary to confirm these predictions.

What experimental approaches can identify the DNA-binding motifs and regulatory targets of YddM?

To characterize YddM's function as a putative transcription factor, several complementary experimental approaches should be employed:

1. ChIP-seq analysis:

  • Express epitope-tagged YddM in B. subtilis

  • Perform chromatin immunoprecipitation followed by next-generation sequencing

  • Identify genome-wide binding sites with peak-calling algorithms

  • Compare binding patterns with other transcription factors

2. RNA-seq differential expression analysis:

  • Generate YddM deletion mutant (yddM::null)

  • Compare transcriptome profiles between wild-type and mutant strains

  • Identify genes with altered expression (typically using ≥2.71-fold difference threshold)

  • Validate key findings with RT-qPCR

3. DNA-binding motif determination:

  • Perform electrophoretic mobility shift assays (EMSA) with purified recombinant YddM

  • Use systematic evolution of ligands by exponential enrichment (SELEX) to identify preferred binding sequences

  • Employ DNase I footprinting to precisely map protection regions

  • Validate binding motifs through reporter gene assays using predicted target promoters

These approaches would reveal the regulatory network controlled by YddM, similar to how LutR's regulon was characterized in B. subtilis .

How might post-translational modifications affect YddM function?

Post-translational modifications (PTMs) can significantly impact transcription factor activity. For YddM, potential PTMs to investigate include:

Modification TypeDetection MethodFunctional ImpactAnalysis Approach
PhosphorylationMass spectrometry, Phos-tag gelsAltered DNA binding affinityCompare binding of phosphomimetic vs. non-phosphorylatable mutants
AcetylationAnti-acetyl-lysine antibodies, MS/MSChanged protein stabilityMonitor protein turnover rates with/without deacetylase inhibitors
OxidationRedOx proteomics, MSStress-responsive regulationTest DNA binding under oxidative stress conditions
Proteolytic processingWestern blot, N-terminal sequencingGeneration of active fragmentsExpress truncated versions to identify minimal functional domain

Examining how these modifications affect YddM in different growth phases and stress conditions would provide insights into the contextual regulation of its activity. For example, LutR shows maximum expression at the onset of stationary phase when grown in PA medium , suggesting similar growth phase-dependent regulation might occur for YddM.

What are the optimal conditions for assessing YddM's DNA-binding activity in vitro?

To effectively assess YddM's DNA-binding activity, researchers should consider the following protocol:

Buffer composition:

  • 20 mM Tris-HCl (pH 7.5-8.0)

  • 50-150 mM NaCl (optimize salt concentration)

  • 1-5 mM MgCl₂

  • 1 mM DTT

  • 5% glycerol

  • 0.1 mg/mL BSA (to prevent non-specific binding)

Electrophoretic Mobility Shift Assay (EMSA) procedure:

  • Purify recombinant His-tagged YddM using affinity chromatography followed by size-exclusion chromatography

  • Use fluorescently labeled DNA fragments (25-35 bp) containing putative binding sites

  • Incubate 50-100 nM YddM with 10 nM labeled DNA for 30 minutes at 25°C

  • Resolve complexes on 6% non-denaturing polyacrylamide gels

  • Include competition assays with unlabeled specific and non-specific DNA fragments

Controls and variations:

  • Test binding under different pH conditions (pH 6.5-8.5)

  • Examine the effects of divalent cations (Mg²⁺, Ca²⁺, Zn²⁺) on binding affinity

  • Include a known transcription factor-DNA complex as positive control

  • Perform binding reactions at different temperatures to determine thermodynamic parameters

This approach can be adapted from methods used to study DNA binding of other B. subtilis transcription factors in the GntR family, similar to LutR .

How can researchers generate and validate a yddM knockout strain in Bacillus subtilis?

Creating and validating a yddM knockout strain requires several careful steps:

Generation methods:

  • Long-flanking homology PCR approach:

    • Design primers to amplify ~1 kb regions upstream and downstream of yddM

    • Join these regions to an antibiotic resistance cassette (e.g., spectinomycin)

    • Transform B. subtilis with the construct and select for antibiotic resistance

  • CRISPR-Cas9 method:

    • Design sgRNA targeting yddM sequence

    • Create repair template with antibiotic marker

    • Co-transform with Cas9 plasmid and repair template

    • Screen for successful editing events

Validation protocol:

  • Genotypic confirmation:

    • PCR verification using primers flanking the integration site

    • Sanger sequencing to confirm precise modification

    • Whole-genome sequencing to rule out off-target effects

  • Transcriptional validation:

    • RT-qPCR to confirm absence of yddM transcript

    • RNA-seq to assess global transcriptional changes

  • Phenotypic characterization:

    • Growth curve analysis under various conditions

    • Stress response evaluation

    • Biofilm formation assessment

    • Sporulation efficiency measurement

This approach is similar to the methodology used to create and validate the lutR::Tn10::spc (TEK1) mutant strain for studying LutR function .

What considerations are important when designing experiments to identify protein-protein interactions involving YddM?

When investigating protein-protein interactions involving YddM, researchers should consider multiple complementary approaches:

In vivo approaches:

  • Bacterial two-hybrid system:

    • Fuse YddM to T18 fragment of adenylate cyclase

    • Screen against a library of B. subtilis proteins fused to T25 fragment

    • Monitor reporter gene activation indicating interaction

  • Co-immunoprecipitation:

    • Express epitope-tagged YddM in B. subtilis

    • Perform IP followed by mass spectrometry to identify interacting partners

    • Validate interactions with reverse co-IP experiments

In vitro approaches:

  • Pull-down assays:

    • Use purified His-tagged YddM as bait

    • Incubate with B. subtilis cell lysate

    • Identify bound proteins by mass spectrometry

  • Surface plasmon resonance (SPR):

    • Immobilize YddM on sensor chip

    • Flow candidate interacting proteins

    • Determine binding kinetics and affinity constants

Specific considerations for YddM:

  • Test interactions under different growth phases, particularly early stationary phase

  • Examine interactions in the presence/absence of DNA containing binding sites

  • Investigate potential interactions with other transcription factors, such as SinR, which has been shown to work cooperatively with other regulators like LutR

  • Consider potential post-translational modifications that might affect interaction profiles

Understanding YddM's protein-protein interaction network would provide valuable insights into its regulatory mechanisms and biological function in B. subtilis.

What approaches can be used to determine if YddM functions as part of a regulatory network similar to LutR?

To investigate whether YddM functions within a regulatory network similar to LutR, researchers should implement a multi-faceted approach:

1. Comparative transcriptomics:

  • Perform RNA-seq comparing wild-type, yddM mutant, and lutR mutant strains

  • Generate double knockout (yddM/lutR) to assess potential overlapping regulatory roles

  • Analyze data at different growth phases, particularly at the onset of stationary phase

  • Identify genes that show similar or divergent expression patterns between the mutants

2. Chromatin landscape analysis:

  • Conduct ChIP-seq for both YddM and LutR under identical conditions

  • Compare binding profiles to identify shared and unique targets

  • Perform sequential ChIP (re-ChIP) to detect co-occupancy at specific genomic loci

3. Protein-protein interaction studies:

  • Test direct interaction between YddM and LutR using in vitro methods

  • Perform electrophoretic mobility shift assays with both proteins to test for cooperative binding, similar to the approach that revealed cooperation between LutR and SinR

  • Use bacterial two-hybrid or bimolecular fluorescence complementation to assess interactions in vivo

4. Phenotypic characterization:

  • Compare phenotypes of single and double mutants for processes regulated by LutR, including:

    • Antibiotic production

    • Biofilm formation

    • Sporulation

    • Metabolism of specific carbon sources

These approaches would help establish whether YddM and LutR operate in parallel, sequential, or interconnected regulatory pathways in B. subtilis.

How might structural analysis of YddM inform development of novel antimicrobial strategies?

Understanding the structure-function relationship of YddM could contribute to antimicrobial development through several potential avenues:

Structural characterization approaches:

  • X-ray crystallography of purified recombinant YddM

  • Cryo-electron microscopy for structural determination

  • NMR spectroscopy for dynamic structural analysis

  • Hydrogen-deuterium exchange mass spectrometry to identify functional domains

If YddM proves to be essential or important for B. subtilis pathogenicity or survival, structural insights could enable:

  • Structure-based design of small molecule inhibitors targeting YddM's DNA-binding domain

  • Development of peptide mimetics that disrupt essential protein-protein interactions

  • Identification of allosteric sites that could be targeted to modulate YddM activity

This approach would be analogous to targeting other bacterial transcription factors for antimicrobial development, with the advantage that YddM likely has no human homologs, potentially reducing off-target effects.

What is the evolutionary conservation of YddM across bacterial species, and what does this suggest about its function?

To assess the evolutionary conservation of YddM:

Bioinformatic analysis approach:

  • Perform BLAST searches across bacterial genomes to identify homologs

  • Construct multiple sequence alignments to identify conserved domains

  • Generate phylogenetic trees to visualize evolutionary relationships

  • Apply methods similar to those used for YdcI analysis across Gram-negative strains

Functional implications to investigate:

  • Correlation between YddM conservation and specific bacterial lifestyles or habitats

  • Identification of highly conserved residues that may be crucial for function

  • Presence of YddM homologs in pathogenic vs. non-pathogenic bacteria

  • Co-evolution with putative target genes

This evolutionary perspective would provide context for YddM's biological role and could help prioritize aspects of the protein for further functional studies. If YddM proves to be highly conserved across diverse bacterial species, it may indicate a fundamental role in bacterial physiology.

How does the membrane topology of YddM affect its function as a transcription factor?

Based on the amino acid sequence analysis, YddM appears to contain hydrophobic regions that could potentially interact with membranes, which is unusual for transcription factors:

Experimental approaches to characterize membrane association:

  • Membrane fractionation:

    • Separate cytoplasmic, membrane, and periplasmic fractions

    • Detect YddM localization by Western blotting

  • Protease accessibility assays:

    • Treat intact cells, spheroplasts, and membrane vesicles with proteases

    • Analyze proteolytic fragments to determine exposed regions

  • Fluorescence microscopy:

    • Create YddM-fluorescent protein fusions

    • Visualize subcellular localization under different conditions

Functional implications to investigate:

  • Role of potential membrane association in sensing environmental signals

  • Mechanism of transition between membrane-associated and DNA-binding states

  • Comparison with other membrane-associated transcription factors

  • Effect of membrane composition on YddM activity

Understanding these aspects would provide critical insights into YddM's mechanism of action, particularly if it functions as a membrane-associated transcription factor that responds to specific environmental cues by altering its localization or conformation.

What are the critical quality control parameters for recombinant YddM protein preparations?

To ensure reliable results when working with recombinant YddM, researchers should implement the following quality control procedures:

Purity assessment:

  • SDS-PAGE analysis (should demonstrate >90% purity)

  • Size-exclusion chromatography to verify homogeneity

  • Dynamic light scattering to detect aggregation

Functional validation:

  • DNA-binding activity assays using putative target sequences

  • Circular dichroism spectroscopy to confirm proper folding

  • Thermal shift assays to assess protein stability

Storage stability monitoring:

  • Activity testing after different storage durations

  • Assessment of freeze-thaw stability

  • Evaluation of different buffer formulations

Each new preparation should be benchmarked against previous batches using standardized assays to ensure consistency in experimental results. Detailed documentation of expression conditions, purification steps, and quality control outcomes should be maintained for reproducibility.

How can researchers distinguish between direct and indirect regulatory effects of YddM in transcriptome studies?

Distinguishing direct from indirect regulatory effects requires a systematic approach:

Experimental strategy:

  • Integrated ChIP-seq and RNA-seq analysis:

    • Compare YddM binding sites (ChIP-seq) with differentially expressed genes (RNA-seq)

    • Genes showing both YddM binding and expression changes are candidate direct targets

    • Genes with expression changes but no binding may be indirectly regulated

  • Temporal resolution:

    • Use time-course experiments after YddM induction/depletion

    • Direct targets typically show more rapid expression changes

    • Indirect targets show delayed responses

  • Motif analysis:

    • Identify DNA-binding motifs from ChIP-seq data

    • Test if presence of motifs correlates with expression changes

    • Mutate motifs in reporter constructs to validate direct regulation

  • In vitro transcription:

    • Reconstitute transcription system with purified components

    • Test YddM's ability to directly affect transcription from target promoters

This approach is similar to methods used to identify the 11 single genes and 25 operons that are directly controlled by LutR in B. subtilis , providing a framework for distinguishing YddM's direct and indirect regulatory effects.

What considerations are important when designing experiments to study YddM function across different growth phases?

When investigating YddM function across different growth phases, researchers should consider:

Experimental design factors:

  • Controlled growth conditions:

    • Use chemically defined media with consistent composition

    • Maintain precise temperature, aeration, and pH control

    • Consider batch-to-batch variations in complex media components

  • Sampling strategy:

    • Collect samples at multiple defined points (lag, exponential, transition, early stationary, late stationary)

    • Use OD600 measurements and growth curve standardization

    • Consider parallel sampling for different analyses (RNA, protein, metabolites)

  • Expression monitoring:

    • Construct transcriptional and translational yddM-reporter fusions (similar to lutR-lacZ)

    • Monitor expression levels throughout growth

    • Correlate with specific cellular events

Data analysis considerations:

  • Normalize expression data to appropriate reference genes for each growth phase

  • Account for global transcriptional/translational changes during growth phase transitions

  • Use time-series analysis methods to identify temporal patterns

This approach would reveal how YddM expression and activity change throughout the B. subtilis life cycle, similar to how LutR expression was found to reach maximum levels at the onset of stationary phase (OD600 ~7) in PA medium .

How should researchers approach the development of antibodies specific to YddM for immunological detection?

Developing specific antibodies against YddM requires careful planning:

Antigen design strategies:

  • Full-length protein approach:

    • Use purified recombinant His-tagged YddM as immunogen

    • Ensure high purity (>95%) to minimize non-specific antibodies

  • Peptide-based approach:

    • Identify immunogenic epitopes using prediction algorithms

    • Select 2-3 peptides from different regions (15-20 amino acids each)

    • Conjugate to carrier protein (KLH or BSA)

Antibody production considerations:

  • Choose between polyclonal (broader epitope recognition) and monoclonal (higher specificity)

  • Select appropriate animal species (rabbit, mouse, chicken)

  • Include pre-immune serum collection for negative controls

Validation requirements:

  • Western blot against recombinant YddM and B. subtilis lysates

  • Compare wild-type and yddM deletion strains

  • Test cross-reactivity with related proteins

  • Validate for specific applications (IP, ChIP, immunofluorescence)

Properly validated antibodies would enable various applications including protein level quantification, localization studies, and chromatin immunoprecipitation experiments essential for understanding YddM's function in vivo.

What implications does the study of uncharacterized proteins like YddM have for our understanding of bacterial gene regulation?

Studying uncharacterized proteins like YddM has several important implications:

  • Discovery of novel regulatory mechanisms:

    • May reveal previously unknown DNA-binding motifs or regulatory principles

    • Could identify new types of environmental sensing mechanisms

  • Completion of regulatory networks:

    • Helps fill gaps in our understanding of bacterial transcriptional networks

    • May reveal connections between previously unrelated physiological processes

  • Evolutionary insights:

    • Provides perspective on the conservation and divergence of regulatory systems

    • May reveal lineage-specific adaptations in bacterial gene regulation

  • Practical applications:

    • Potential identification of new antimicrobial targets

    • Possible biotechnological applications for synthetic biology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.