Recombinant Bacillus subtilis Uncharacterized protein ydgD (ydgD)

Shipped with Ice Packs
In Stock

Description

Introduction to Bacillus subtilis and Uncharacterized Proteins

Bacillus subtilis is a gram-positive, rod-shaped bacterium that has served as a model organism for studying bacterial cellular processes for decades. Its genome was one of the first bacterial genomes to be completely sequenced, revealing numerous genes encoding proteins of unknown function. These "uncharacterized proteins" represent significant knowledge gaps in our understanding of bacterial physiology and metabolism.

The systematic inactivation of B. subtilis genes has previously revealed that 271 genes are indispensable for growth, with several encoding proteins of unknown function . Through systematic approaches including protein depletion studies and subcellular localization experiments, researchers have begun elucidating the functions of these uncharacterized proteins. For example, some novel essential proteins appear to be involved in lipid synthesis and control of cell wall synthesis .

B. subtilis is particularly notable for its ability to form endospores – highly resistant dormant structures that can survive extreme environmental conditions. These endospores can later germinate into vegetative cells when favorable conditions return. The endospore structure includes protective layers such as the dehydrated core containing the genome, the peptidoglycan cortex layer providing heat resistance, and outer coat layers protecting against damaging chemicals and enzymes . Many uncharacterized proteins may play roles in these complex developmental processes.

Characteristics and Structure of ydgD Protein

The uncharacterized protein ydgD from Bacillus subtilis is a relatively small protein consisting of 114 amino acids. According to available data, the complete amino acid sequence of ydgD is: "MISIMMKVSLAVFMLAGGIIKVSRVPFQVEHWRHYQYPLWFLTVTGILEIAGALAMTAGIWNRYAAIGAGVLFVVLMAGAIHAHMFRARQSVIMAIQAMICLIVSIMIIMGSYT" . This protein is encoded by the ydgD gene, also known as BSU05590 in the B. subtilis genome .

Analysis of the amino acid sequence suggests ydgD is likely a membrane-associated protein, given its composition of hydrophobic amino acid stretches that could form transmembrane domains. The presence of multiple hydrophobic regions is consistent with membrane-spanning segments, suggesting ydgD may function in the cell membrane of B. subtilis, potentially involved in transport or signaling processes. This membrane localization would be similar to other B. subtilis proteins like StoA, which is membrane-associated and plays a role in endospore biogenesis .

While the three-dimensional structure of ydgD has not been definitively determined according to the available search results, the protein's relatively small size and potential membrane association present both challenges and opportunities for structural studies. Many membrane proteins adopt distinctive structural folds that facilitate their functions in lipid bilayers.

Research Approaches to Characterizing Uncharacterized Proteins

The characterization of uncharacterized proteins like ydgD typically follows several established methodologies in bacterial genetics and biochemistry. These approaches have been successfully applied to other uncharacterized proteins in B. subtilis and could be relevant for elucidating ydgD function.

One productive approach involves analyzing the effects of protein depletion on cellular functions. For example, in studies of other uncharacterized B. subtilis proteins, researchers have created conditional mutants to examine the consequences of protein absence on cellular viability and growth . This approach has revealed that some previously considered "essential" proteins may not actually be required for viability under laboratory conditions, as was found for ydiB, yloQ, yqeI, and ywlC .

Subcellular localization studies represent another valuable method for inferring protein function. Through fluorescent protein fusions or immunofluorescence microscopy, researchers can determine where proteins like ydgD localize within the cell. Such studies have shown, for instance, that the uncharacterized protein YkqC co-localizes with ribosomes in B. subtilis, suggesting a potential role in processing either rRNA or specific mRNAs associated with ribosomes .

Evolutionary analysis using genomic phylostratigraphy has emerged as a powerful approach for understanding the evolutionary age of B. subtilis genes, including those involved in sporulation processes . This method has revealed that B. subtilis sporulation genes cluster in several groups that emerged at distant evolutionary time points, suggesting the sporulation process underwent several stages of expansion through evolution . Similar analysis could provide insights into the evolutionary origins and potential functions of ydgD.

Potential Functions of ydgD in Bacillus subtilis

While the specific function of ydgD remains uncharacterized, several hypotheses can be formulated based on knowledge of other B. subtilis proteins and comparative analyses.

Given its apparent membrane-associated nature, ydgD might function in membrane transport, cell signaling, or membrane structural integrity. The membrane localization is suggested by the amino acid sequence, which contains multiple hydrophobic regions characteristic of transmembrane domains .

The protein could potentially be involved in sporulation processes, which are central to B. subtilis biology. Research has shown that many previously uncharacterized genes in B. subtilis are involved in sporulation, with 16 out of 37 (43%) tested uncharacterized genes showing significant effects on sporulation when inactivated . Specific uncharacterized proteins like yscB, ygaB, and ykqC were found to influence forespore development and heat resistance of spores .

Another possibility is that ydgD may participate in the general stress response of B. subtilis. The bacterium employs a complex regulatory network controlled by the sigma factor σB to respond to various environmental stresses . Numerous genes under σB control encode proteins of unknown function, some of which have been identified through computer-aided analysis of the B. subtilis genome for σB-dependent promoters .

The protein could also function similarly to thiol-disulfide oxidoreductases (TDORs) like StoA, which plays a role in the synthesis of the endospore peptidoglycan cortex protective layer . These proteins typically contain active site cysteines and adopt a thioredoxin-like fold structure, catalyzing the reduction of disulfide bonds or oxidation of thiols .

Research Applications and Study Techniques

Recombinant ydgD protein serves as a valuable tool for various research applications aimed at elucidating its function and potential biotechnological applications. The availability of purified protein with N-terminal His-tag facilitates numerous in vitro studies .

Structural biology techniques, including X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, and cryo-electron microscopy, could be employed to determine the three-dimensional structure of ydgD. These approaches have been successful with other B. subtilis proteins like StoA, revealing structural features such as the thioredoxin-like fold and active site conformations .

Protein-protein interaction studies using techniques such as pull-down assays, co-immunoprecipitation, or yeast two-hybrid screening could identify binding partners of ydgD, providing insights into its functional networks. The recombinant His-tagged version of the protein is particularly amenable to pull-down experiments that can capture interaction partners from B. subtilis cell lysates.

Functional genomics approaches, including systematic gene knockouts or CRISPR-Cas9-mediated gene editing, could help assess the phenotypic consequences of ydgD deletion or mutation. Similar approaches with other uncharacterized genes have revealed their involvement in processes like sporulation, with distinct phenotypic categories emerging based on the formation of visible forespores and heat-resistant spores .

Comparative genomics across different Bacillus species and related genera could provide evolutionary context for ydgD, potentially revealing conserved domains or motifs that suggest functional roles. This approach aligns with phylostratigraphic methods that have successfully identified evolutionary patterns in sporulation genes .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, specified tag requests should be communicated to ensure preferential development.
Synonyms
ydgD; BSU05590; Uncharacterized protein YdgD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ydgD
Target Protein Sequence
MISIMMKVSLAVFMLAGGIIKVSRVPFQVEHWRHYQYPLWFLTVTGILEIAGALAMTAGI WNRYAAIGAGVLFVVLMAGAIHAHMFRARQSVIMAIQAMICLIVSIMIIMGSYT
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bacillus subtilis Uncharacterized protein ydgD and how does it relate to other uncharacterized proteins?

Recombinant Bacillus subtilis Uncharacterized protein ydgD represents one of many proteins in biological databases whose functions remain to be fully elucidated. Similar to other uncharacterized proteins like yddG, it is part of the significant portion of proteins categorized under "unknown function" in biological databases, including the Protein Data Bank (PDB) . Recent analyses indicate that approximately 42.53% of PDB entries categorized as "unknown function" are genuinely uncharacterized, while the remainder could potentially have their annotations reassessed based on new experimental data or computational function inference approaches . Uncharacterized proteins like ydgD are typically identified through genomic sequencing of B. subtilis strains but lack experimental validation of their biological roles.

The scientific interest in ydgD stems from broader efforts to understand the complete functional proteome of B. subtilis, which serves as a model organism in molecular biology. Similar uncharacterized proteins in B. subtilis, such as yddG, have been characterized as membrane proteins with specific amino acid sequences that may suggest functional roles . Unlike characterized proteins with established functions, ydgD requires comprehensive experimental strategies to determine its cellular role, potential interaction partners, and contribution to bacterial physiology.

What storage and handling protocols are recommended for recombinant B. subtilis uncharacterized proteins?

Optimal storage and handling of recombinant B. subtilis uncharacterized proteins follows protocols similar to those for yddG, which has been more extensively studied . The recommended storage conditions include:

Storage ConditionTemperatureDurationNotes
Long-term storage-20°C to -80°CMonthsAvoid repeated freeze-thaw cycles
Working aliquots4°CUp to one weekFor ongoing experiments
Buffer compositionTris-based buffer with 50% glycerol-Optimized for protein stability

Repeated freezing and thawing should be strictly avoided as it can lead to protein degradation and loss of potential biological activity . For experiments requiring regular use, creating small working aliquots stored at 4°C is recommended to preserve the integrity of the main stock. The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized to maintain protein stability and prevent aggregation . When designing experiments, researchers should consider that uncharacterized proteins may have unknown cofactor requirements or sensitivity to specific experimental conditions.

How should researchers design experiments to investigate potential functions of uncharacterized proteins like ydgD?

Effective experimental design for investigating uncharacterized proteins like ydgD requires a systematic approach following key principles of experimental methodology . The process should begin with clear variable definition:

  • Define your variables carefully:

    • Independent variable: The experimental manipulation (e.g., expression levels of ydgD)

    • Dependent variable: The measured outcome (e.g., growth rate, stress response, metabolite production)

    • Extraneous variables: Factors requiring control (e.g., temperature, media composition)

  • Form testable hypotheses based on:

    • Sequence homology with characterized proteins

    • Predicted structural features

    • Genomic context and gene neighborhood analysis

    • Transcriptomic data showing co-expression patterns

  • Design appropriate controls:

    • Negative controls (e.g., strains without the ydgD gene)

    • Positive controls (e.g., strains with known proteins of similar predicted function)

    • Vehicle controls if chemical treatments are used

  • Select appropriate experimental approaches based on protein properties and research questions. Methods might include gene knockout studies, protein-protein interaction assays, localization studies, or phenotypic screens under various stress conditions .

When designing these experiments, researchers should consider both between-subjects designs (comparing different strains) and within-subjects designs (measuring the same strain under different conditions), selecting the approach that minimizes confounding variables and provides the most robust results .

What transcriptomic approaches can reveal potential functions of uncharacterized proteins in B. subtilis?

Transcriptomic approaches have proven valuable for inferring functions of uncharacterized proteins, as demonstrated in recent B. subtilis studies. A comprehensive approach involves designing experiments that dynamically probe principal cellular pathways using global gene transcription compendiums . Recent work with B. subtilis has generated extensive transcriptional profiles covering 4,002 protein-coding genes from 403 samples across 38 separate experimental designs, including time series data that improves the ability to infer directed regulatory edges .

Key methodological considerations include:

  • Experimental design should capture diverse physiological states including:

    • Complete life cycles (germination to sporulation)

    • Stress responses

    • Specialized states (e.g., competence, biofilm formation)

  • Time-series data collection:

    • Samples at regular intervals (e.g., 30-minute intervals during life cycle transitions)

    • Capturing rapid changes in gene expression during stress responses

  • Network component analysis (NCA) combined with model selection to:

    • Estimate transcription factor activities

    • Learn expanded transcriptional regulatory networks

    • Predict novel regulatory interactions

This approach has successfully identified 2,258 novel regulatory interactions in B. subtilis with 62% experimental validation accuracy . For uncharacterized proteins like ydgD, analyzing their expression patterns across these comprehensive datasets can reveal co-regulation with proteins of known function, suggesting potential involvement in similar cellular processes or pathways.

How can horizontal gene transfer experiments be designed to study the evolutionary significance of uncharacterized proteins?

Horizontal gene transfer (HGT) experiments offer valuable insights into the evolutionary significance of uncharacterized proteins like ydgD. A methodologically sound approach involves serial dilution evolution experiments that assess:

  • The contribution of HGT from adapted donors to the recipient's adaptation process under stress conditions

  • The dynamics of foreign DNA acquisition and its propagation in evolving populations

  • The dependence of acquisition on phylogenetic distance between donor and recipient genomes

A validated experimental protocol involves:

Experimental StepMethodologyDurationKey Considerations
Growth medium preparationLB with 0.8M NaCl + antibiotic selection-Stress condition must provide multiple adaptive solutions
Serial dilution1:120 dilution into fresh mediumDailyCorresponds to ~7 generations daily
DNA supplementation~2 μg foreign DNA mixtureDailyEqual amounts from various sources
Total durationSerial passages72 daysApproximately 504 generations
ReplicationIndependent repeats-Minimum of 3 replicates recommended

Fitness measurement of strains containing acquired foreign DNA can be performed through competition-based assays, where cells containing foreign DNA fragments are competed against control strains in both standard and stress conditions . Quantification involves sequencing samples at different time points and determining the fraction of donor variants, allowing calculation of relative fitness advantages conferred by the acquired genes .

What approaches can determine if an uncharacterized protein participates in specific transcriptional regulatory networks?

Determining whether an uncharacterized protein like ydgD participates in transcriptional regulatory networks requires sophisticated methodological approaches combining experimental data with computational modeling. Effective strategies include:

  • Network Component Analysis (NCA) combined with model selection:

    • Simultaneously estimate transcription factor activities

    • Learn expanded transcriptional regulatory networks

    • Predict novel regulatory interactions with statistical confidence

  • Integration of multiple data types:

    • Previously validated regulatory interactions as a "gold standard" prior network

    • Transcriptomic data across diverse conditions

    • ChIP-chip or ChIP-seq data for direct binding evidence

    • Genetic perturbation studies (e.g., gene knockouts)

  • Experimental validation of predicted interactions:

    • Direct measurement of regulatory effects through reporter gene assays

    • Assessment of binding through electrophoretic mobility shift assays

    • Mutational analysis of predicted binding sites

This comprehensive approach has demonstrated success in B. subtilis studies, where researchers predicted 2,258 novel regulatory interactions and experimentally validated 391 out of 635 tested interactions, achieving 62% accuracy . For uncharacterized proteins like ydgD, these methods can identify potential regulatory relationships even before the protein's precise biochemical function is known.

How should researchers reconcile contradictory results from different functional prediction methods?

Reconciling contradictory results from different functional prediction methods represents a common challenge when studying uncharacterized proteins like ydgD. A systematic approach involves:

  • Hierarchical evaluation of prediction methods based on:

    • Method sensitivity and specificity for the protein family

    • Nature of the underlying data (structural, sequence, or network-based)

    • Evolutionary distance of reference organisms used in the method

  • Integration of multiple prediction approaches:

    • Sequence-based methods (BLAST, HMM profiles)

    • Structure-based predictions (threading, ab initio modeling)

    • Context-based methods (gene neighborhood, fusion events)

    • Experimental data from related proteins

  • Weighted consensus strategy:

    • Assign confidence scores to each prediction method

    • Develop a weighted consensus prediction

    • Prioritize experimental validation based on consensus strength

When evaluating functional predictions, it's important to recognize that approximately 57.47% of proteins previously labeled as "unknown function" in databases like PDB can now be reassessed based on new experimental data or improved computational approaches . This suggests that contradictions between prediction methods may reflect the evolving state of knowledge rather than fundamental theoretical disagreements.

What statistical approaches are most appropriate for evaluating evolutionary conservation patterns?

Statistical approaches for evaluating evolutionary conservation patterns of uncharacterized proteins should be selected based on the specific research questions and data characteristics:

Statistical ApproachAppropriate ForStrengthsLimitations
Phylogenetic profilingIdentifying functionally related proteinsDetects co-evolution patternsRequires diverse genomes
Rate4Site algorithmIdentifying functionally important residuesSite-specific evolutionary ratesRequires good alignment quality
Hidden Markov ModelsDetecting distant homologsSensitive to remote relationshipsMay miss highly divergent homologs
Relative entropy analysisQuantifying conservation constraintsMeasures information contentSensitive to alignment quality
Bayesian approachesIntegrating diverse conservation signalsHandles uncertaintyComputationally intensive

When applying these methods to uncharacterized proteins like ydgD, researchers should consider that proteins with unknown function may contain both highly conserved domains (suggesting essential functions) and variable regions (potentially indicating species-specific adaptations). The interpretation should be guided by established knowledge about the selective pressures operating in the bacterial species being studied.

What emerging technologies show promise for characterizing previously uncharacterized proteins?

Several emerging technologies show particular promise for elucidating the functions of previously uncharacterized proteins like ydgD:

  • AlphaFold and other AI-based structural prediction tools:

    • Generate highly accurate structural models

    • Predict protein-protein interactions

    • Identify potential binding sites and catalytic residues

  • Single-cell transcriptomics and proteomics:

    • Reveal cell-to-cell variation in expression

    • Identify condition-specific activation

    • Detect rare cellular states where the protein may be important

  • CRISPR-based functional genomics:

    • Systematic gene interruption or modulation

    • Multiplex phenotypic screening

    • Precise genetic manipulation in native genomic context

  • Metabolomics combined with genetic perturbations:

    • Identify metabolic changes upon gene deletion or overexpression

    • Detect potential substrates or products

    • Place proteins within metabolic networks

  • Spatial proteomics approaches:

    • Determine subcellular localization with high precision

    • Identify interaction partners in their native context

    • Visualize dynamic changes in response to stimuli

These technologies, when applied in combination, create a powerful platform for systematic characterization of uncharacterized proteins like ydgD in B. subtilis, potentially revealing connections to established cellular pathways and processes.

How might experimental evolution approaches advance our understanding of uncharacterized proteins?

Experimental evolution represents a powerful approach for understanding the functional significance of uncharacterized proteins like ydgD in B. subtilis. These methods can reveal selective pressures acting on genes under defined conditions and identify evolutionary trajectories that illuminate protein function .

Key methodological considerations include:

  • Selection of appropriate stress conditions:

    • Conditions should challenge bacterial survival and growth

    • Multiple potential adaptive solutions should be available

    • Stress should be consistently applicable over long-term experiments

  • Time-scale considerations:

    • Long-term evolution (500+ generations) captures rare adaptive events

    • Short-term competition assays quantify immediate fitness effects

    • Time-series sampling enables tracking of evolutionary dynamics

  • Integration with genetic engineering:

    • Controlled introduction of genetic variants

    • Competition experiments between engineered strains

    • Fitness measurements under varying conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.