Recombinant Bacillus subtilis Uncharacterized protein yebC (yebC)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Expression Systems

Recombinant yebC is primarily expressed in Escherichia coli using in vitro systems, as evidenced by commercial product specifications . Key production details include:

  • Expression Host: E. coli (commonly used for cost-effective recombinant protein synthesis) .

  • Tagging: N-terminal 10xHis-tag for purification via nickel affinity chromatography .

  • Protein Length: Full-length (267 amino acids) or partial versions .

While B. subtilis is a well-established host for recombinant protein production due to its GRAS status and efficient secretion systems , yebC recombinants are currently synthesized in E. coli. This choice may reflect technical challenges in expressing eukaryotic-like proteins in B. subtilis or the need for simpler purification protocols.

Gene Family and Evolutionary Relationships

The YebC family includes proteins with divergent roles:

  • Transcription Factors: E. coli YebC and Pseudomonas aeruginosa PmpR regulate gene expression .

  • Translation Factors: B. subtilis YebC2 and Streptococcus pyogenes YebC_II resolve ribosome stalling at polyproline tracts .

Notably, B. subtilis yebC clusters phylogenetically with transcription factors, distinct from translation-related YebC2 homologs . This suggests yebC may function in transcriptional regulation, though experimental validation is lacking.

Potential Applications

While no functional studies on yebC exist, its availability as a recombinant protein enables:

  1. Structural Analysis: X-ray crystallography or cryo-EM to elucidate domain architecture.

  2. Functional Screens: Testing interactions with RNA polymerase or ribosomal components.

  3. Comparative Genomics: Investigating conservation across Gram-positive bacteria.

Challenges and Future Directions

  1. Functional Elucidation: Current annotations label yebC as "uncharacterized," highlighting the need for hypothesis-driven studies.

  2. Expression Optimization: Exploring B. subtilis-based production systems to improve yield or native folding.

  3. Interdisciplinary Collaboration: Leveraging bioinformatics tools to predict binding partners or catalytic sites.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please specify your preference in order notes for preparation according to your needs.
Lead Time
Delivery times may vary based on purchasing methods and locations. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize development accordingly.
Synonyms
yebC; BSU06380; Uncharacterized protein YebC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yebC
Target Protein Sequence
MTEERKETFEEEINQSERIDADEEPLSRMSRKASRQSKQKQKQKQKPRQERGESTVKDKL ASVWAAINRYCGFAFSILKSPAKTVVTDGFSHYKYGLISMLIFSIIFSIGNWFQLKASWN RPLGFGERHHAFYDGFLVVLVYLLIFFAVMVFAIWAVSRYMMKQKVTFREAAAVLGSLLV PVIAVSILWLIFAIVNIPMLTVLFTVLILFSIFFIIALYVQRVYQAAQDAPIDYIYCVFA VVAIALLFTAVTWPFISEYITASLIPL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the YebC protein family in Bacillus subtilis and how are these proteins classified?

The YebC protein family in B. subtilis includes multiple members with distinct functions. Based on phylogenetic analysis, YebC family proteins cluster into divergent clades that correlate with their functions rather than species phylogeny . In B. subtilis specifically, there are different YebC family proteins including YebC2 (formerly called YeeI) which functions as a translation factor, and YrbC which clusters with transcription factors . These proteins are part of a larger family that has evolved separate lineages for transcription and translation functions with 99.9% maximum likelihood bootstrap value supporting this division .

What experimental evidence supports the function of YebC2 in B. subtilis?

YebC2 in B. subtilis functions as a translation factor that resolves ribosome stalling at polyproline tracts . The evidence supporting this function includes:

  • Direct demonstration that YebC2 interacts with 70S ribosomes

  • Observation that cells lacking both EF-P and YebC2 exhibit severe ribosome stalling at polyproline tracks in vivo

  • Experiments showing that overexpression of YebC2 in Δefp cells reduces ribosome stalling

  • Genetic studies revealing that depleting EF-P from ΔyebC2 cells causes severe fitness defects

  • Rescue experiments demonstrating that YebC2 overexpression significantly improves fitness in Δefp ΔyfmR cells

How does the function of YebC2 in B. subtilis compare to YebC proteins in other bacterial species?

YebC proteins across different bacterial species have diverse functions:

  • B. subtilis YebC2: Functions as a translation factor resolving ribosome stalling at polyprolines

  • E. coli, L. delbrueckii, B. burgdorferi, and P. aeruginosa YebC: Function primarily as transcription factors

  • S. pyogenes YebC2: Shares a common ancestor with B. subtilis YebC2 and likely functions similarly in translation

  • Human YebC homolog TACO1: Localizes to mitochondria and is important for efficient translation of COXI

Interestingly, E. coli YebC can resolve ribosome stalling at polyprolines despite being classified phylogenetically with transcription factors, suggesting potential dual functionality .

How do YebC2, EF-P, and YfmR cooperate to maintain cellular fitness in B. subtilis?

YebC2, EF-P, and YfmR function independently through separate mechanisms to prevent ribosome stalling and support cellular fitness in B. subtilis. Experimental evidence shows:

  • Depleting EF-P from ΔyebC2 cells causes a severe fitness defect

  • This defect is even more severe in ΔyebC2 ΔyfmR cells

  • Overexpression of YebC2 in Δefp Δyfmr cells significantly improves fitness, as measured by colony size

  • Similarly, expression of YfmR in ΔefpΔyebC2 cells can rescue growth

  • The simultaneous loss of all three factors (YebC2, EF-P, and YfmR) severely reduces B. subtilis viability

This indicates these factors represent complementary systems that have evolved to prevent ribosome stalling at polyproline tracts through distinct mechanisms.

What are the molecular mechanisms by which YebC2 resolves ribosome stalling?

YebC2 resolves ribosome stalling at polyproline tracts through direct interaction with the ribosome. The detailed mechanism includes:

  • Association with 70S ribosomes, demonstrated through co-sedimentation experiments

  • Direct binding to stalled ribosomes at polyproline motifs

  • Promotion of peptide bond formation to continue protein synthesis

  • Function independent of EF-P's mechanisms, which require post-translational modifications by EpmA and EpmB

  • Potential structural rearrangements of the ribosome to facilitate peptidyl transfer

The complete molecular details remain to be fully elucidated, but evidence indicates YebC2 acts directly on the translation machinery rather than through transcriptional regulation.

How can the evolutionary relationship between YebC transcription factors and YebC2 translation factors be leveraged for protein engineering?

The divergent evolution of YebC family proteins offers opportunities for protein engineering:

  • Domain swapping experiments:

    • Exchange domains between transcription-associated YebC proteins and translation-associated YebC2 proteins

    • Identify critical regions responsible for ribosome binding versus DNA binding

    • Create chimeric proteins with novel or enhanced functions

  • Site-directed mutagenesis targets:

    • Focus on residues conserved within functional clades but divergent between clades

    • Modify residues in E. coli YebC that might confer dual functionality

    • Enhance specificity for particular polyproline motifs

  • Design of synthetic translation factors:

    • Use the YebC2 scaffold to create optimized variants for biotechnology applications

    • Develop synthetic proteins that can rescue translation of difficult-to-express proteins

    • Engineer translation factors with broader substrate specificity

What experimental protocols are recommended for studying YebC2-ribosome interactions?

To study YebC2-ribosome interactions effectively:

  • Ribosome binding assays:

    • Purify ribosomes from B. subtilis using sucrose gradient ultracentrifugation

    • Express and purify recombinant YebC2 with appropriate tags

    • Perform binding assays under physiological conditions

    • Use Western blotting to detect co-sedimentation with 70S ribosomes

  • In vivo ribosome stalling analysis:

    • Create reporter constructs containing polyproline motifs

    • Compare expression levels in wild-type versus ΔyebC2 strains

    • Use ribosome profiling to map ribosome occupancy at polyproline tracts

    • Quantify effects of YebC2 overexpression on stalling resolution

  • Structural studies:

    • Perform cryo-electron microscopy of YebC2-ribosome complexes

    • Use crosslinking mass spectrometry to identify interaction points

    • Apply molecular dynamics simulations to predict conformational changes

What strategies can be used to differentiate the roles of YebC versus YebC2 in B. subtilis?

To experimentally distinguish YebC and YebC2 functions:

  • Gene deletion and complementation:

    • Create single and double knockout strains

    • Test complementation with each gene

    • Assess phenotypes related to transcription and translation

    • Measure synthetic genetic interactions with other factors

  • Functional assays:

    • For transcription factor activity: Use promoter-reporter fusions to measure YebC-dependent gene expression

    • For translation factor activity: Quantify ribosome stalling at polyproline motifs using ribosome profiling

    • Compare binding preferences using EMSA for DNA binding (YebC) versus ribosome binding assays (YebC2)

    • Assess impacts on fitness under various stress conditions

  • Protein localization:

    • Use fluorescent protein fusions to track cellular localization

    • Determine if YebC associates with nucleoid versus YebC2 with ribosomes

    • Employ cellular fractionation to separate cytoplasmic, membrane, and nucleoid fractions

What are the optimal conditions for transformation of B. subtilis for yebC/yebC2 studies?

Based on established B. subtilis transformation protocols:

  • Two-step transformation protocol:

    • Grow cells at 37°C in MNGE medium containing 2% glucose, 0.2% potassium glutamate, 100 mM potassium phosphate buffer (pH 7), 3.4 mM trisodiumcitrate, 3 mM MgSO₄, 42 μM ferric ammonium citrate, 0.24 mM L-tryptophan, and 0.1% casein hydrolyzate

    • During transition from exponential to stationary phase, dilute with fresh MNGE medium (without casein hydrolyzate)

    • Incubate for 1 hour at 37°C with shaking

    • Add 250 ng of chromosomal DNA to 400 μl of cells and incubate for 30 minutes

    • Add expression mix (2.5% yeast extract, 2.5% casein hydrolyzate, 1.22 mM tryptophan)

    • Grow for 1 hour before plating on selective media

  • Strain considerations:

    • For inducible expression studies, add appropriate inducers (e.g., 0.5% xylose for xylose-inducible promoters)

    • Consider using competence-proficient laboratory strains as backgrounds

    • Monitor for potential effects of YebC/YebC2 manipulation on transformation efficiency itself

How can contradictory results in YebC family protein studies be reconciled?

To reconcile contradictory findings in YebC protein research:

  • Consider evolutionary context:

    • Recognize that YebC family proteins have diverged into distinct functional clades

    • Some proteins may retain dual functionality (e.g., E. coli YebC can resolve ribosome stalling despite clustering with transcription factors)

    • Evaluate each protein based on its phylogenetic classification rather than nomenclature alone

  • Experimental design factors:

    • Growth conditions may affect which function predominates

    • Protein expression levels can influence functional outcomes

    • Genetic background differences (particularly in translation factors) may alter results

    • Consider cell wall properties, as these can affect protein function and cellular phenotypes

  • Integrative analysis approach:

    • Combine multiple experimental modalities (genetic, biochemical, structural)

    • Corroborate findings across different model systems

    • Consider evolutionary conservation patterns when interpreting functional data

What bioinformatic analysis methods are most appropriate for studying evolutionary relationships among YebC family proteins?

For robust evolutionary analysis of YebC proteins:

  • Sequence analysis pipeline:

    • Collect diverse YebC family sequences using PSI-BLAST or HMMer

    • Perform multiple sequence alignment with MUSCLE or MAFFT

    • Trim alignments to remove poorly aligned regions using trimAl

    • Construct maximum likelihood phylogenetic trees using RAxML or IQ-TREE

    • Assess node support with bootstrap values (aim for >95% at key nodes)

  • Structure-function correlation:

    • Map conserved residues onto predicted structures

    • Identify residues that differentiate transcription versus translation functions

    • Use ConSurf to visualize evolutionary conservation patterns

    • Apply protein-protein interaction prediction tools to identify potential binding interfaces

  • Comparative genomics:

    • Analyze gene neighborhoods for functional associations

    • Examine co-evolution patterns with other translation or transcription factors

    • Compare evolutionary rates between different YebC clades

How can researchers interpret differences in phenotypic effects when manipulating yebC versus yebC2 in B. subtilis?

When interpreting differential phenotypic effects:

  • Consider functional redundancy:

    • Determine if other factors can compensate for loss of either protein

    • Measure synthetic genetic interactions with related factors (e.g., EF-P, YfmR)

    • Quantify expression levels of potential compensatory genes in single mutants

  • Assess broader cellular impacts:

    • Measure effects on cell wall properties, as YebC family manipulation can alter cell wall thickness

    • Consider impacts on other cellular processes like biofilm formation, which can be affected by changes in cell wall composition

    • Examine effects on competence development, which involves complex regulatory networks

  • Context-dependent analysis:

    • Compare phenotypes under different growth conditions

    • Assess effects during different growth phases

    • Consider effects of host immune responses if studying pathogenic bacteria

    • Evaluate phenotypes in the presence of antibiotics or other stressors

What unresolved questions remain about YebC/YebC2 function in B. subtilis?

Several key questions remain unanswered:

  • Molecular mechanism questions:

    • What is the precise binding site of YebC2 on the 70S ribosome?

    • How does YebC2 facilitate peptide bond formation at polyproline motifs?

    • What structural changes occur during YebC2-mediated rescue of stalled ribosomes?

  • Regulatory questions:

    • How is YebC2 expression regulated in response to cellular stresses?

    • Do post-translational modifications affect YebC2 activity?

    • What signals trigger the recruitment of YebC2 to stalled ribosomes?

  • Evolutionary questions:

    • When did the functional divergence between YebC and YebC2 occur?

    • Why have multiple systems (EF-P, YebC2, YfmR) evolved to resolve polyproline stalling?

    • Are there species-specific differences in YebC2 function across different Bacillus species?

How might YebC2 research inform synthetic biology applications?

YebC2 research has potential applications in synthetic biology:

  • Enhanced protein production:

    • Engineering YebC2 variants to improve expression of polyproline-containing proteins

    • Developing expression systems with optimized YebC2 levels for difficult-to-express proteins

    • Creating synthetic circuits that modulate YebC2 expression in response to ribosome stalling

  • Antimicrobial development:

    • Targeting YebC2-ribosome interactions as a novel antibiotic strategy

    • Exploiting differences between bacterial YebC2 and human TACO1 for selectivity

    • Developing combination therapies targeting multiple translation rescue factors

  • Biotechnology applications:

    • Using YebC2 to improve production of industrially relevant enzymes containing polyproline motifs

    • Developing biosensors based on YebC2-dependent translation of reporter proteins

    • Engineering B. subtilis strains with optimized translation efficiency for bioproduction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.