Recombinant Bacillus subtilis Uncharacterized protein yesK (yesK)

Shipped with Ice Packs
In Stock

Description

Introduction to yesK

The yesK gene in Bacillus subtilis encodes an uncharacterized protein classified among the "Uncharacterized protein" families in bacterial genomics. While the protein has been recombinantly expressed for research purposes, its specific biological function, structural features, and biochemical activity remain poorly understood. Below is a synthesis of available data and insights into its potential roles.

Genomic and Expression Context

AttributeDetails
Gene IDNot explicitly provided in public databases (e.g., UniProt, NCBI).
Genomic LocusPart of the B. subtilis genome, likely localized to operons or prophage regions.
Expression SystemsRecombinant production typically involves E. coli or yeast hosts .
TaggingHis-tagged versions are available for purification .
Purity>80% by SDS-PAGE (commercial standards) .

Note: Specific details about yesK's gene sequence, subcellular localization, or homologs are not publicly documented.

Research Challenges and Gaps

Despite its inclusion in commercial recombinant protein catalogs , yesK lacks characterized functional data. Key limitations include:

  1. Functional Annotation: No studies explicitly link yesK to metabolic pathways, stress responses, or protein-protein interactions.

  2. Structural Insights: Predicted secondary structures (e.g., alpha-helices, beta-sheets) or catalytic motifs remain unverified.

  3. Experimental Validation: No peer-reviewed publications or biochemical assays (e.g., enzymatic activity tests, binding assays) are available.

Hypothetical Roles Based on Homology

While direct evidence is absent, yesK may belong to broader functional categories common in B. subtilis:

Potential RoleRationale
Membrane-associated proteinMany uncharacterized B. subtilis proteins are membrane-bound .
Stress responseB. subtilis uncharacterized genes often encode stress-response factors .
Sporulation or biofilm formationB. subtilis uncharacterized proteins may regulate developmental pathways .

Recombinant Production and Applications

Commercially available yesK proteins are typically expressed in heterologous hosts:

Host SystemAdvantagesChallenges
E. coliHigh yield, cost-effective Potential misfolding or lack of post-translational modifications
YeastBetter eukaryotic-like foldingLower throughput compared to E. coli

These recombinant versions are used in structural studies, antibody generation, or screens for functional activity.

Future Research Directions

To elucidate yesK's function, researchers could pursue:

  1. Bioinformatic Analysis:

    • BLAST searches against Pfam or CATH databases to identify conserved domains.

    • Prediction of subcellular localization (e.g., cytoplasmic, membrane, extracellular).

  2. Experimental Approaches:

    • In vivo knockout studies in B. subtilis to assess phenotypic changes.

    • Co-purification with known proteins to infer interaction networks.

  3. Biochemical Assays:

    • Screening for enzymatic activity (e.g., hydrolases, kinases).

    • Binding assays to identify ligands or DNA/RNA targets.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs during order placement. We will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
yesK; BSU06930; Uncharacterized protein YesK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yesK
Target Protein Sequence
MSFSKREAGDVWSILFVTGIVTACLFAGVSVLMRMRFPDKSRPEWMLAGLIVLGVFAIWY SLVYVRGWEGAALGMLGFNVIFGAIAGYLIDKAIRRYRKR
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YisK and what is its fundamental role in Bacillus subtilis?

YisK is an uncharacterized protein in Bacillus subtilis that has been shown to interact genetically with the elongasome protein Mbl. Research has demonstrated that YisK belongs to the fumarylacetoacetate hydrolase (FAH) superfamily and possesses oxaloacetate decarboxylase activity. It is notable as the first example of an enzyme implicated in central carbon metabolism with subcellular localization that depends on the actin-like protein Mbl . The protein's overexpression leads to cell widening and lysis, phenotypes that are dependent on mbl and can be suppressed by mbl mutations .

What expression patterns does YisK exhibit under different growth conditions?

YisK protein expression varies depending on growth conditions. Western blot analysis using polyclonal antibodies has shown that YisK reaches maximal levels around 60 minutes post-resuspension in sporulation medium . In casein hydrosylate (CH) medium, YisK becomes detectable during early exponential growth (OD600 0.3-0.6) and reaches maximum levels between OD600 readings of 3.6 and 4.6, corresponding to when cells begin entering the sporulation program . In LB medium supplemented with 10.0 mM MgCl2 (LB-Mg), YisK is detectable during early exponential growth but increases to higher levels at the transition state and beyond . These expression patterns suggest YisK accumulates both under conditions favorable for sporulation and in growth media that doesn't support sporulation.

How stable is YisK when expressed as a fusion protein?

When expressed as a GFP "sandwich" fusion (YisK SW-GFP), where GFP is introduced into a non-conserved loop between residues E111 and A112, the protein remains stable. Western blot analysis has confirmed that YisK SW-GFP is detected as a single band using both anti-YisK and anti-GFP antibodies, indicating the fusion is not proteolyzed . This stability is critical for accurate localization studies and functional analysis of the protein.

How does YisK localize within B. subtilis cells and what factors determine this localization?

YisK exhibits a distinctive localization pattern within B. subtilis cells. Using epifluorescence microscopy with a YisK SW-GFP fusion expressed from the native locus, researchers observed that YisK localizes both diffusely and in punctate arrangements . This localization pattern is consistent across different growth media including sporulation medium, CH, and LB . Critically, YisK's punctate localization is dependent on the elongasome protein Mbl. In cells with mbl deletion, YisK SW-GFP displays completely diffuse localization, whereas it maintains punctate localization in wild-type cells and in ΔponA cells . This Mbl-dependent localization suggests a functional relationship between YisK and the cell envelope synthesis machinery.

What specific domains of YisK are essential for proper localization?

The small domain of YisK, particularly residue E30, is crucial for proper localization. A YisK E30A substitution variant maintains wild-type enzymatic activity in vitro and proper protein folding (as evidenced by wild-type self-interaction in bacterial two-hybrid assays), but exhibits only diffuse localization when expressed as YisK SW-GFP E30A from YisK's native promoter . This finding indicates that the small domain is important for YisK's Mbl-dependent punctate localization and ability to perturb Mbl function. Importantly, this localization does not depend on YisK's catalytic activity, as a catalytically inactive variant (YisK E148A E150A) still exhibits punctate localization .

What methodological approaches are most effective for studying YisK localization?

The most effective approach for studying YisK localization involves creating a fluorescent GFP "sandwich" fusion (YisK SW-GFP) by introducing GFP into a non-conserved loop in YisK between residues E111 and A112 . This construct can be expressed either from an IPTG-inducible promoter or from the native YisK promoter following allelic exchange. Epifluorescence microscopy can then be used to visualize YisK localization patterns. Western blot analysis using both anti-YisK antibodies (diluted 1:10,000 in rabbit serum) and anti-GFP antibodies helps confirm fusion protein stability and expression levels . For protein detection, horseradish peroxidase-conjugated goat anti-rabbit IgG secondary antibody (1:5,000 dilution) and SuperSignal West Femto maximum sensitivity substrate provide optimal results .

What enzymatic activity does YisK possess and what are its kinetic parameters?

YisK has been demonstrated to catalyze the decarboxylation of oxaloacetate (OAA) to pyruvate and CO2 . Kinetic analysis has determined that YisK exhibits a Km of 134 μM for OAA and a Kcat of 31 min-1 . While this turnover rate is relatively slow compared to typical enzymes, it is significantly faster than the spontaneous decarboxylation of OAA, providing approximately 30 times enhancement based on estimated intracellular OAA concentrations of 0.5 μM (as in E. coli) . Crystal structures have revealed close structural similarity to two other OAA decarboxylases: human mitochondrial FAHD1 and Corynebacterium glutamicum Cg1458 .

Is oxaloacetate likely to be YisK's preferred substrate?

The relatively modest turnover rate (31 min-1) for OAA decarboxylation by YisK raises questions about whether OAA is indeed YisK's preferred substrate. Several possibilities exist: (1) OAA might not be the preferred substrate, and further testing may identify better candidates; (2) the modest catalytic enhancement over spontaneous decarboxylation could be sufficient for cellular needs, especially considering YisK's relative abundance; (3) YisK's punctate localization might allow for higher local concentrations in vivo, enhancing its activity; (4) the in vitro assay may lack factors that enhance YisK activity in vivo; or (5) YisK might function more as a metabolite sensor than an enzyme, potentially adjusting elongasome function upon ligand binding or release .

How do catalytic mutations affect YisK function and localization?

A catalytically inactive YisK variant (YisK E148A E150A) retains wild-type localization as puncta and still widens cells following overexpression, indicating these activities are not dependent on YisK's catalytic function . This variant has low affinity for ligands and no detectable enzymatic activity, suggesting that YisK's localization and interaction with the elongasome do not require catalytic activity or ligand binding . Conversely, the YisK E30A variant retains wild-type enzymatic activity in vitro but localizes diffusely and no longer widens cells following overexpression . These findings suggest a separation between YisK's enzymatic function and its role in cell morphology.

What structural features characterize YisK and how do they relate to its function?

YisK belongs to the fumarylacetoacetate hydrolase (FAH) superfamily and crystal structures have revealed close structural similarity to oxaloacetate decarboxylases, specifically human mitochondrial FAHD1 and Corynebacterium glutamicum Cg1458 . The protein contains a small domain with a cluster of charged residues (EKK), including E30, which is critical for localization but not enzymatic activity . The catalytic residues E148 and E150 are essential for enzymatic activity but not for localization . This structural organization suggests a modular design where different domains control distinct functions of YisK - localization versus catalytic activity.

How can researchers perform effective structural analysis of YisK?

Structural analysis of YisK has been achieved through X-ray crystallography, yielding insights into its functional domains and relation to the FAH superfamily . For expression and purification, researchers can use protocols involving SDS-PAGE polyacrylamide gels (12%) for protein separation, followed by transfer to nitrocellulose membrane at 100V for 60 minutes . For immunodetection, membranes should be blocked in 1× PBS containing 0.05% Tween-20 and 5% dry milk powder, then probed with anti-YisK antibody (1:10,000 dilution) followed by horseradish peroxidase-conjugated secondary antibody . Signal detection can be achieved using SuperSignal West Femto maximum sensitivity substrate and appropriate imaging systems .

What is the physiological significance of YisK's Mbl-dependent localization?

YisK represents the first example of an enzyme implicated in central carbon metabolism with subcellular localization that depends on the actin-like protein Mbl . This unique localization pattern suggests a potential spatial regulation of metabolic activity that is coordinated with cell envelope synthesis. The fact that YisK overexpression leads to cell widening and lysis in an Mbl-dependent manner indicates a functional relationship between YisK and the elongasome complex that guides lengthwise growth in bacteria . This spatial coupling of metabolism and cell envelope synthesis may represent a previously unrecognized regulatory mechanism in bacterial physiology.

What are the optimal conditions for expressing and detecting YisK in B. subtilis?

For optimal expression and detection of YisK, researchers should consider the following conditions:

  • Growth media: YisK is expressed in sporulation by resuspension medium, casein hydrosylate (CH) medium, and LB supplemented with 10.0 mM MgCl2 (LB-Mg) .

  • Growth phase: Maximum expression occurs around 60 minutes post-resuspension in sporulation medium, at OD600 3.6-4.6 in CH medium, and during transition state and beyond in LB-Mg .

  • Detection method: Western blot analysis using polyclonal antibody raised against YisK (1:10,000 dilution) is effective for detecting native YisK .

  • Visualization: For localization studies, a YisK SW-GFP fusion expressed from either an IPTG-inducible promoter or the native locus provides reliable results .

How can researchers effectively study the relationship between YisK and the elongasome?

To study the relationship between YisK and the elongasome, researchers should:

  • Generate strains with combinations of YisK variants and deletions of elongasome components (particularly Mbl) .

  • Create a strain background permissive for Mbl deletion by deleting ponA .

  • Compare localization patterns and morphological effects of YisK in wild-type versus Mbl-deleted backgrounds .

  • Utilize fluorescent fusions of both YisK and elongasome components to observe co-localization or mutual exclusion .

  • Test the effects of YisK overexpression on cell morphology in different genetic backgrounds .

What methodologies can be used to investigate YisK's enzymatic activity in vitro?

For investigating YisK's enzymatic activity in vitro, researchers can employ spectrophotometric assays measuring the conversion of oxaloacetate to pyruvate . The catalytic parameters (Km = 134 μM, Kcat = 31 min-1) provide a baseline for comparison with mutant variants . When testing YisK variants, researchers should confirm proper protein folding through methods like bacterial two-hybrid assays for self-interaction . For comprehensive analysis, researchers should compare enzymatic activity with localization patterns and morphological effects to understand the relationship between YisK's biochemical activity and its cellular function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.