Recombinant Bacillus subtilis Uncharacterized protein yfhL (yfhL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Uncharacterized Protein yfhL (yfhL)

Recombinant Bacillus subtilis Uncharacterized protein yfhL (yfhL) is a bioengineered protein derived from the yfhL gene of Bacillus subtilis, a Gram-positive bacterium widely used in biotechnological applications. The protein remains functionally uncharacterized, but its recombinant production has been optimized for structural and functional studies. This article synthesizes available data on its production, structural characteristics, and research applications, drawing from commercial catalogs, peer-reviewed studies, and technical specifications.

Research Applications and Functional Implications

While the yfhL gene’s biological role remains undefined, recombinant yfhL serves as a tool for:

  1. Structural Proteomics: Resolving its transmembrane topology and interactions with cellular components.

  2. Functional Screening: Identifying potential roles in cellular processes (e.g., stress response, metabolic regulation) through knockdown or overexpression studies.

  3. Comparative Genomics: Aligning yfhL orthologs across Bacillus species to infer evolutionary conserved functions.

Current Limitations:

  • No peer-reviewed studies explicitly linking yfhL to specific biochemical pathways or phenotypes.

  • Commercial applications remain focused on basic research rather than therapeutic or industrial use.

Comparative Analysis of Expression Systems

FactorBacillus subtilisE. coli
Protein YieldHigh secretion efficiency for extracellular proteinsModerate yield for cytoplasmic proteins
Secretion PathwaysUtilizes Sec and Tat systems for extracellular targetingLimited secretion; cytoplasmic retention common
Post-Translational ModificationsLimited compared to eukaryotesNone; suited for prokaryotic proteins

For yfhL, E. coli is preferred for simplicity and cost-effectiveness, though B. subtilis could enable future secretion studies if functional motifs (e.g., signal peptides) are identified .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yfhL; BSU08580; Uncharacterized protein YfhL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yfhL
Target Protein Sequence
MTGLVGGGLMIIAGILIKLFPPKSINSVYGYRTRRSMSDQRLWNEANRYSASLMILSGLV IAGMGLLLGSNLFILQLILLIAACVITFMLTEKRLKIMTHSQGGDRSGRS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the uncharacterized protein yfhL in Bacillus subtilis?

The yfhL protein is one of several proteins in the B. subtilis genome whose function remains uncharacterized. While specific functional data is limited, uncharacterized proteins like yfhL typically have preliminary annotations based on genomic context, sequence homology, and predicted structural domains. These proteins represent significant opportunities for discovery as they may have novel functions that contribute to B. subtilis biology. The GRAS (Generally Recognized As Safe) status of B. subtilis makes studying its uncharacterized proteins potentially valuable for biotechnological applications .

Why are proteins like yfhL still considered "uncharacterized" despite advanced genomic techniques?

Despite sophisticated genomic analysis tools, proteins like yfhL remain uncharacterized due to several factors. First, many proteins lack clear homology to functionally characterized proteins in other organisms. Second, some proteins may be expressed only under specific environmental conditions not typically replicated in laboratory settings. Third, the focus of most research has traditionally been on proteins with obvious phenotypes or clear industrial applications. Evolutionary analysis suggests that uncharacterized proteins may emerge at different phylogenetic timepoints, with yfhL potentially belonging to a specific phylostratum that might indicate its evolutionary age and functional context .

How can we determine if yfhL is essential for B. subtilis survival?

To determine essentiality:

  • Generate knockout mutants using targeted gene deletion techniques

  • Assess growth rates compared to wild-type strains in various media and conditions

  • Perform complementation studies to confirm phenotypes

  • Quantify visible and heat-resistant spores if sporulation is affected

Similar approaches were used for uncharacterized genes like ygaB, yizD, ykzB, and yphF, revealing their roles in sporulation . The following table summarizes typical phenotype analysis methods:

Analysis MethodParameters MeasuredEquipment Required
Growth curvesGrowth rate, lag phase, maximum ODPlate reader/spectrophotometer
MicroscopyMorphological changes, spore formationPhase contrast/fluorescence microscope
Stress resistanceSurvival under temperature, pH, oxidative stressIncubators, plate counters
Heat resistanceSpore viability after heat treatmentWater bath, colony counter

What are the optimal expression systems for producing recombinant yfhL in B. subtilis?

For optimal expression of yfhL, several systems can be employed:

  • Plasmid-based expression: Various plasmids have been developed specifically for B. subtilis, offering different copy numbers, stability characteristics, and expression levels.

  • Promoter selection: The choice between constitutive or inducible promoters depends on research objectives:

    • Constitutive promoters (like P43) for continuous expression

    • Inducible systems like IPTG-inducible Pspac or xylose-inducible PxylA for controlled expression

  • Self-inducible systems: These eliminate the need for expensive inducers and are gaining popularity for their practicality and cost-effectiveness .

The optimal system depends on whether yfhL might be toxic when overexpressed, if post-translational modifications are needed, and the required yield for downstream applications.

How can signal peptides enhance the expression and purification of recombinant yfhL?

Signal peptides play a crucial role in protein secretion in B. subtilis, which has the remarkable ability to secrete proteins directly into the culture medium, simplifying purification processes. For yfhL expression:

  • Select an appropriate signal peptide (e.g., amyE, aprE, or nprE) to direct secretion

  • Engineer the signal peptide sequence at the N-terminus of the yfhL coding sequence

  • Optimize the signal peptide-protein junction to ensure proper cleavage

  • Monitor protein secretion efficiency using SDS-PAGE and Western blotting

B. subtilis secretes proteins primarily through the Sec and Tat pathways, with most heterologous proteins utilizing the Sec pathway . Secreted proteins avoid intracellular proteolytic degradation and eliminate the need for cell disruption during purification, significantly reducing downstream processing costs.

What strategies can overcome potential bottlenecks in yfhL expression?

Common bottlenecks in recombinant protein expression in B. subtilis include:

  • Codon optimization: Adjusting the coding sequence to match B. subtilis codon preferences to enhance translation efficiency

  • Extracellular protease inactivation: Using protease-deficient strains (e.g., WB800 with eight extracellular proteases deleted) to prevent degradation of secreted yfhL

  • Optimization of induction parameters: Fine-tuning inducer concentration, induction timing, and culture conditions

  • Co-expression of chaperones: Including molecular chaperones to ensure proper folding, especially if yfhL tends to form inclusion bodies

  • Rational engineering of promoters: Using double promoters or synthetic promoters to enhance transcription levels

These strategies should be systematically tested to determine the optimal conditions for high-level, soluble yfhL expression.

What initial experimental approaches should be used to begin characterizing the function of yfhL?

Initial characterization of yfhL should follow a systematic approach:

  • Bioinformatic analysis:

    • Sequence homology searches against characterized proteins

    • Domain prediction and structural modeling

    • Genomic context analysis (neighboring genes often have related functions)

  • Expression analysis:

    • RT-qPCR to determine conditions under which yfhL is expressed

    • Western blotting to detect native protein levels

    • Transcriptomics to identify co-expressed genes

  • Localization studies:

    • GFP fusion constructs to determine subcellular localization

    • Fractionation studies to determine if yfhL is cytoplasmic, membrane-associated, or secreted

  • Phenotypic screening:

    • Growth under various stress conditions (temperature, pH, salt, antibiotics)

    • Morphological examination, especially if sporulation is affected

This multi-faceted approach provides complementary data that can guide more targeted experiments.

How can protein interaction studies help determine the function of yfhL?

Protein interaction studies are powerful tools for functional characterization:

  • Pull-down assays: Using tagged yfhL to identify binding partners by mass spectrometry

  • Bacterial two-hybrid systems: Screening for interacting proteins in vivo

  • Co-immunoprecipitation: Confirming specific interactions under native conditions

  • Protein crosslinking: Capturing transient interactions that might be missed by other methods

  • Surface plasmon resonance (SPR): Determining binding kinetics for identified interactions

Interactions with proteins of known function can provide insights into potential roles of yfhL. For example, if yfhL interacts with known sporulation proteins, it might participate in spore formation processes, a crucial aspect of B. subtilis biology .

What rational protein design approaches can help deduce the function of yfhL?

Rational protein design approaches can provide valuable insights into yfhL function:

  • Structure-guided mutagenesis:

    • Identify and mutate potential catalytic residues

    • Disrupt predicted binding sites to assess functional impacts

  • Domain swapping:

    • Replace domains with homologous regions from characterized proteins

    • Create chimeric proteins to test functional hypotheses

  • Hierarchical design strategy:

    • Begin with simpler modifications and progressively introduce complexity

    • Test the effects of each modification on protein function

  • Computational design tools:

    • Use molecular dynamics simulations to predict effects of mutations

    • Apply folding prediction algorithms to design stabilizing mutations

This design cycle, alternating between theory and experiment, allows for testing hypotheses about yfhL function through iterative refinement . Each round of design and testing provides new insights that guide subsequent experiments.

How can evolutionary analysis help predict the function of yfhL?

Evolutionary analysis provides valuable context for understanding yfhL:

  • Phylostratigraphy:

    • Determine when yfhL emerged during evolution

    • Identify proteins that emerged in the same phylostratum, as they may share functional relationships

  • Comparative genomics:

    • Identify yfhL orthologs across bacterial species

    • Map conservation patterns to infer functional importance of specific regions

  • Synteny analysis:

    • Examine gene neighborhood conservation across species

    • Identify functionally linked gene clusters

The phylostratigraphic approach has successfully predicted involvement of uncharacterized genes in sporulation, with 43% of tested strains showing sporulation phenotypes when these genes were inactivated . Applying similar methods to yfhL could reveal its functional role, particularly if it belongs to phylostrata enriched for sporulation genes (PS2 or PS8-10).

Is yfhL potentially involved in sporulation based on genomic analysis?

To assess potential involvement in sporulation:

  • Determine the phylostratum of yfhL (PS2 and PS8-10 are particularly enriched for sporulation genes)

  • Check if yfhL is expressed during sporulation using proteomics or GFP reporter systems

  • Assess conservation patterns across spore-forming and non-spore-forming bacteria

  • Generate knockout strains and quantify:

    • Visible spore formation

    • Heat-resistant spore counts

    • Timing of sporulation initiation

    • Morphological defects in spores

If yfhL belongs to sporulation-enriched phylostrata and its protein is detected during sporulation, it would be a strong candidate for involvement in this process . Testing would involve categorizing the phenotype similar to other uncharacterized genes like ygaB (category I), yizD (category II), ykzB (category III), and yphF (category IV), which showed different patterns of effects on visible and heat-resistant spore formation.

What can structural genomics reveal about the potential function of yfhL?

Structural genomics approaches offer powerful insights into protein function:

  • Structure prediction:

    • Use AlphaFold or RoseTTAFold to generate predicted structures

    • Identify potential active sites or binding pockets

  • Structural classification:

    • Compare predicted structures with known protein folds

    • Identify structural homology even when sequence homology is low

  • Molecular docking:

    • Predict potential substrates or binding partners

    • Guide experimental validation of interactions

  • Structure-based functional annotation:

    • Use structure-function relationships to infer possible activities

    • Identify conserved structural motifs associated with specific functions

The rational protein design cycle emphasizes the importance of structural understanding as a foundation for functional hypothesis generation . Even partial structural information can guide experimental design for functional characterization.

How can integrated omics approaches accelerate the functional characterization of yfhL?

Integrated omics strategies provide a systems-level understanding of yfhL:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data from yfhL-knockout strains

    • Identify perturbed pathways that suggest functional roles

  • Condition-specific analysis:

    • Compare omics profiles under various stress conditions

    • Identify conditions that specifically affect yfhL expression or function

  • Network analysis:

    • Construct protein-protein interaction networks

    • Identify functional modules containing yfhL

  • Flux analysis:

    • Measure metabolic flux changes in yfhL mutants

    • Identify affected biochemical pathways

This integrated approach can detect subtle phenotypes that might be missed by traditional methods and place yfhL in its broader biological context, particularly if it functions as part of a larger system or pathway.

What CRISPR-based methods can be applied to study yfhL function?

CRISPR technology offers powerful tools for yfhL characterization:

  • CRISPRi for conditional knockdown:

    • Create dCas9-based transcriptional repression of yfhL

    • Enable tunable, reversible suppression to study essential functions

  • CRISPRa for overexpression:

    • Use modified dCas9 systems to upregulate yfhL expression

    • Assess gain-of-function phenotypes

  • CRISPR screening:

    • Perform genome-wide screens to identify genetic interactions with yfhL

    • Discover synthetic lethal or synthetic rescue relationships

  • Base editing:

    • Introduce specific point mutations without double-strand breaks

    • Create targeted amino acid substitutions to test structure-function hypotheses

These approaches allow for precise genetic manipulation and can reveal functional relationships that traditional methods might miss.

How should results from yfhL studies be validated to ensure reproducibility?

Ensuring reproducibility in yfhL characterization requires:

  • Complementation studies:

    • Reintroduce wild-type yfhL to confirm phenotype rescue

    • Use site-directed mutants to identify critical functional residues

  • Multiple strain backgrounds:

    • Test phenotypes in different B. subtilis strains

    • Validate findings across genetic contexts

  • Orthogonal methods:

    • Confirm key findings using alternative experimental approaches

    • Validate protein interactions using multiple techniques

  • Quantitative analysis:

    • Apply statistical methods appropriate for the experimental design

    • Report effect sizes and confidence intervals, not just p-values

  • Data sharing:

    • Deposit complete datasets in appropriate repositories

    • Share detailed protocols on platforms like protocols.io

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.