Recombinant Bacillus subtilis Uncharacterized protein yhcE (yhcE)

Shipped with Ice Packs
In Stock

Description

Production & Purification

The protein is synthesized in Escherichia coli expression systems and purified via immobilized metal affinity chromatography (IMAC) leveraging its His-tag. Critical production parameters include:

ParameterDetails
Expression HostE. coli
Purity≥85–90% (verified by SDS-PAGE)
FormulationLyophilized powder in Tris/PBS buffer (pH 8.0) with 6% trehalose
Storage-20°C/-80°C; reconstitution in sterile water or glycerol-containing buffers
StabilitySensitive to repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week .

Functional Context and Knowledge Gaps

  • Uncharacterized Role: YhcE’s biological function in B. subtilis remains unknown, though its gene neighbors (e.g., yhcS, encoding a sortase) suggest potential involvement in cell wall anchoring or stress response .

  • Contrast with YhcR: Unlike YhcE, the B. subtilis surface protein YhcR has been studied extensively. YhcR is anchored via the YhcS sortase, enabling its use in surface-display biotechnology applications .

Future Directions

Recombinant YhcE serves as a foundational tool for:

  • Functional Proteomics: CRISPR knockouts or pull-down assays to identify interactors.

  • Structural Resolution: Cryo-EM or X-ray crystallography to elucidate membrane topology.

  • Biotechnological Engineering: Potential fusion with reporter enzymes, pending discovery of its native sorting signals.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your desired format in the order notes, and we will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipment is preferred, please notify us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yhcE; BSU09050; Uncharacterized protein YhcE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yhcE
Target Protein Sequence
MNSFLGLLKKDIKLSRMWLLVWICGIIFLLGTGHIIASRTKEPLVIFGFFVAVAFFLLFL SPVFVFYHLRKEGKSQLWLYNPNGGLWLFSSKLAASLLYQFVIQLALTAYGIWMYHMLSV KNLLEHQVDITSTVALLNMYGLISSLDMSVTVIVFWTVFHSLRNWRGMRWAAMVLLVAMW LFFDEYIISPLVESQKHFWPVTVYCNFDFHFHNVWRLELKPIHLSVLGFPIAIVITFLLL IMASKLLDRKVEV
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is currently known about the YhcE protein in Bacillus subtilis?

YhcE is an uncharacterized protein in Bacillus subtilis that appears to be part of an ABC transporter operon. Current structural analysis indicates that YhcE contains six putative membrane-spanning domains (MSDs), suggesting it functions as a membrane component within this transport system. While the specific function of YhcE remains unclear, it exists in an operon alongside other proteins such as YhcH and YhcI, which are believed to form components of an ABC transporter system .

YhcE's genomic context places it in the prkA-addAB region of the B. subtilis chromosome. This region contains several ABC-like transporters, with YhcE specifically being part of a transporter system where YhcI (homologous to BcrB from Bacillus licheniformis) likely constitutes the membrane component, and YhcH potentially functions as the substrate-binding domain .

How is the yhcE gene organized within the B. subtilis genome?

The yhcE gene is located within an operon structure in the prkA-addAB region of the B. subtilis chromosome. It is organized alongside other genes that encode components of an ABC transporter system. Specifically, the operon includes yhcH (likely encoding a substrate-binding domain) and yhcI (encoding a membrane component with six membrane-spanning domains homologous to BcrB from B. licheniformis) .

This genomic organization provides important contextual information suggesting that YhcE functions as part of a transport system. The gene arrangement within this region includes multiple ABC transporter components, reflecting the common functional clustering of related genes in bacterial operons .

What structural features characterize the YhcE protein?

YhcE is primarily characterized by its six putative membrane-spanning domains (MSDs), which strongly suggest its role as a membrane component of an ABC transporter system. This structural feature is typical of proteins involved in substrate translocation across membranes .

Unlike some other components in the same operon, YhcE does not appear to contain ATP-binding domains or substrate-binding domains, which further supports its likely role specifically as the membrane component of the transporter. The presence of six MSDs is consistent with other transmembrane proteins involved in substrate translocation in B. subtilis and related organisms .

What are the optimal conditions for expressing recombinant YhcE protein in B. subtilis?

For optimal expression of recombinant YhcE in B. subtilis, researchers should consider the following methodological approach:

  • Expression system selection: For membrane proteins like YhcE with six membrane-spanning domains, using B. subtilis itself as an expression host often yields better results than heterologous systems, as it provides the native membrane environment and post-translational machinery.

  • Promoter selection: Inducible promoters such as the xylose-inducible system (similar to that used for comK expression in B. subtilis) can provide controlled expression . For membrane proteins like YhcE, moderate expression levels are often preferable to prevent membrane stress and protein aggregation.

  • Growth conditions: Based on protocols used for other B. subtilis proteins, growth at 30°C rather than 37°C following induction can improve proper folding of membrane proteins .

  • Induction timing: Inducing expression during mid-log phase (OD600 of approximately 0.6-0.8) typically provides a balance between cell density and protein production capacity.

  • Media composition: Rich media such as LB can be used, but for membrane proteins, supplementation with additional phospholipids may improve integration into membranes .

What purification strategies are most effective for isolating recombinant YhcE protein?

Purifying membrane proteins like YhcE requires specialized approaches:

  • Membrane fraction isolation: Following cell lysis, differential centrifugation should be employed to isolate membrane fractions. Typically, low-speed centrifugation (5,000-10,000 × g) removes cell debris, followed by high-speed ultracentrifugation (100,000 × g) to pellet membrane fractions.

  • Detergent solubilization: For a protein with six MSDs like YhcE, mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin are recommended for initial solubilization screens, as they maintain protein-protein interactions and functional integrity.

  • Affinity tags: Incorporating a His6-tag (similar to the approach used for the Phy protein in E. coli SD58 ) can facilitate purification using immobilized metal affinity chromatography (IMAC).

  • Buffer optimization: Purification buffers should maintain protein stability while preventing aggregation, typically containing:

    • 20-50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0)

    • 100-300 mM NaCl

    • 5-10% glycerol

    • Critical micelle concentration (CMC) of the selected detergent

    • Protease inhibitors

  • Size-exclusion chromatography: As a final polishing step to separate properly folded protein from aggregates and to assess oligomeric state in detergent micelles.

How can researchers determine the substrate specificity of the ABC transporter containing YhcE?

Determining substrate specificity of an ABC transporter containing YhcE requires a systematic approach:

  • Genetic knockout studies: Create yhcE deletion mutants in B. subtilis (similar to the approach used for yhcR ) and assess phenotypic changes under various growth conditions. This may reveal sensitivity to specific compounds, suggesting potential substrates.

  • Transport assays with reconstituted systems:

    • Purify all components of the ABC transporter (YhcE, YhcH, YhcI)

    • Reconstitute the complex in liposomes

    • Test transport of radioactively or fluorescently labeled potential substrates

    • Monitor substrate accumulation inside liposomes or substrate depletion from the external medium

  • ATPase activity coupling assays: Since ABC transporters couple ATP hydrolysis to substrate transport, measuring ATPase activity in the presence of different potential substrates can indicate substrate recognition.

  • Substrate binding assays with the binding protein component: If YhcH functions as predicted as the substrate-binding domain, perform direct binding assays using:

    • Isothermal titration calorimetry (ITC)

    • Surface plasmon resonance (SPR)

    • Fluorescence-based binding assays

  • Comparative genomics: Analyze conserved genomic context and co-occurrence patterns of yhcE with other genes across different bacterial species, which may provide insights into its functional associations .

What approaches can be used to study YhcE interactions with other components of the ABC transporter system?

Several methodological approaches can be employed to characterize YhcE interactions:

  • In vivo protein-protein interaction studies:

    • Bacterial two-hybrid system

    • Split-GFP complementation assays

    • Förster resonance energy transfer (FRET) with fluorescently tagged proteins

    • Co-immunoprecipitation using specific antibodies or epitope tags

  • In vitro interaction analysis:

    • Co-purification of interacting partners

    • Blue native PAGE to identify stable complexes

    • Pulldown assays using purified components

    • Crosslinking studies followed by mass spectrometry

  • Structural studies to visualize the transport complex:

    • Cryo-electron microscopy of the reconstituted complex

    • X-ray crystallography (challenging for membrane proteins but possible with appropriate stabilization)

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Functional complementation assays:

    • Test whether yhcE from other Bacillus species can complement a yhcE deletion in B. subtilis

    • Construct chimeric proteins with domains from other ABC transporters to identify functional regions

How can transcriptomic analysis help understand the regulation of yhcE expression?

Transcriptomic analysis provides valuable insights into yhcE regulation:

  • RNA-seq approach:

    • Isolate RNA from B. subtilis cultures grown under various conditions (different growth phases, stress conditions, nutrient limitations)

    • Perform RNA-seq to quantify yhcE expression levels

    • Identify conditions that upregulate or downregulate yhcE expression

    • Compare expression patterns with other genes in the ABC transporter operon

  • Promoter analysis and transcription start site mapping:

    • Use 5' RACE (Rapid Amplification of cDNA Ends) to identify the transcription start site

    • Analyze the promoter region for regulatory elements

    • Construct transcriptional fusions with reporter genes (similar to the approach used for yhcS ) to study promoter activity under different conditions

  • Identification of regulatory factors:

    • Perform chromatin immunoprecipitation sequencing (ChIP-seq) with known transcription factors

    • Create transcription factor knockout strains and assess yhcE expression

    • Use electrophoretic mobility shift assays (EMSAs) to identify proteins that bind to the yhcE promoter region

  • Operon structure confirmation:

    • Perform Northern blot analysis (as done for yhcS and ywpE ) to confirm operon structure and co-transcription with other genes

    • Use RT-PCR with primers spanning gene junctions to verify co-transcription

What experimental designs are most effective for studying the impact of yhcE deletion on B. subtilis physiology?

To comprehensively study the impact of yhcE deletion:

  • Construction of genetic knockouts:

    • Create a clean yhcE deletion mutant using allelic replacement techniques

    • Generate complementation strains expressing yhcE from an inducible promoter to confirm phenotypic changes are directly attributable to yhcE loss

    • Create double or triple mutants lacking multiple components of the ABC transporter system

  • Phenotypic characterization:

    • Growth curve analysis under various conditions (different media, temperatures, pH values, osmotic conditions)

    • Stress tolerance assays (antibiotic susceptibility, metal ion sensitivity, oxidative stress)

    • Membrane integrity analysis using membrane-permeable dyes

    • Metabolomic profiling to identify accumulated or depleted metabolites

  • Transport assays:

    • Measure uptake or export of radiolabeled substrates

    • Monitor intracellular accumulation of fluorescent compounds

    • Assess changes in membrane potential using voltage-sensitive dyes

  • Global impact analysis:

    • Transcriptomic analysis to identify compensatory changes in gene expression

    • Proteomic analysis focusing on membrane protein composition

    • Metabolomic analysis to identify changes in cellular metabolism

How can CRISPR-Cas9 technologies be applied to study YhcE function in B. subtilis?

CRISPR-Cas9 technologies offer powerful approaches for studying YhcE:

  • Precise genome editing:

    • Generate clean deletions, point mutations, or domain deletions in yhcE

    • Introduce specific amino acid substitutions in the membrane-spanning domains to assess their importance

    • Create translational fusions with reporter tags at the genomic locus

  • CRISPRi-based repression:

    • Use catalytically inactive Cas9 (dCas9) to repress yhcE expression without permanently altering the genome

    • Implement tunable repression systems to achieve different levels of knockdown

    • Create multiplexed CRISPRi systems targeting multiple components of the ABC transporter simultaneously

  • CRISPR activation (CRISPRa):

    • Use modified dCas9 fused to transcriptional activators to upregulate yhcE expression

    • Study the effects of overexpression on cellular physiology and transport activity

  • CRISPR-based screening:

    • Perform genome-wide CRISPR screens to identify genetic interactions with yhcE

    • Identify synthetic lethal or synthetic rescue interactions that provide insights into function

  • Base editing and prime editing:

    • Use CRISPR-based precision editing to introduce specific mutations without double-strand breaks

    • Systematically mutate conserved residues in membrane-spanning domains to assess functional importance

What computational approaches can predict the structure and function of YhcE?

Advanced computational methods provide valuable insights into YhcE:

  • Homology modeling and threading approaches:

    • Use proteins with known structures as templates for modeling YhcE structure

    • Specifically focus on other ABC transporter membrane components with resolved structures

    • Validate models through molecular dynamics simulations in membrane environments

  • Deep learning approaches:

    • Apply AlphaFold2 or RoseTTAFold to predict YhcE structure from sequence

    • Use these models to identify potential substrate binding sites or protein-protein interaction interfaces

  • Molecular dynamics simulations:

    • Perform simulations of YhcE in lipid bilayers to study conformational dynamics

    • Investigate potential substrate pathways through the membrane domains

    • Study the effects of mutations on protein stability and function

  • Functional prediction using genomic context:

    • Analyze gene neighborhood conservation across bacterial species

    • Identify co-evolution patterns with potential interaction partners

    • Use guilt-by-association approaches based on genomic context across diverse bacterial species

  • Substrate prediction:

    • Use binding site prediction algorithms to identify potential substrate binding pockets

    • Perform virtual screening of potential substrates

    • Analyze conservation patterns in substrate binding regions across related transporters

How does YhcE compare to other membrane components of ABC transporters in B. subtilis?

A comparative analysis of YhcE with other ABC transporter membrane components reveals:

  • Structural comparison:

    • YhcE contains six membrane-spanning domains (MSDs), similar to YhcI and YheI/YheH, which are other membrane components of ABC transporters in B. subtilis

    • Unlike YheI and YheH, which contain both MSDs and ATP-binding domains, YhcE appears to function solely as a membrane component without ATP-binding capability

    • The transmembrane topology of YhcE is similar to other ABC transporter membrane components, but detailed comparative analysis would require experimental verification

  • Functional comparison:

    • YhcE is part of an ABC transporter with unclear function, whereas other B. subtilis ABC transporters have more defined roles:

      • The YheJ-YheH system may be involved in phospholipid transport based on homology to phospholipid methyltransferase

      • The YhaQ-YhaP system is homologous to Na+ ABC transporter proteins NatA and NatB

      • The YhaD-YhaC-YhaB (EcsA-EcsB-EcsC) system is involved in exoprotein production, sporulation, and competence

  • Evolutionary relationships:

    • Analysis of paralogous relationships between ABC transporter components in B. subtilis shows distinct evolutionary lineages

    • YhcE represents one of several paralogs in B. subtilis that function as membrane components of ABC transporters

What can comparative genomics tell us about the conservation and evolution of yhcE across Bacillus species?

Comparative genomics provides evolutionary insights:

  • Conservation analysis:

    • Examine the presence/absence of yhcE homologs across different Bacillus species and related genera

    • Assess sequence conservation patterns, particularly in the membrane-spanning domains

    • Identify species-specific variations that might indicate functional adaptations

  • Synteny analysis:

    • Compare the genomic context of yhcE across Bacillus species to identify conserved operonic structures

    • Evaluate whether yhcE consistently appears with the same partner genes (yhcH, yhcI) across species

    • Identify instances where gene order is disrupted, potentially indicating functional divergence

  • Selection pressure analysis:

    • Calculate dN/dS ratios across yhcE sequences to identify regions under purifying or positive selection

    • Identify functionally important residues based on evolutionary conservation patterns

    • Detect potential coevolution patterns with interacting partners

  • Horizontal gene transfer assessment:

    • Analyze GC content and codon usage bias to detect potential horizontal gene transfer events

    • Construct phylogenetic trees to identify incongruence with species phylogeny

    • This approach is particularly relevant given B. subtilis' natural competence and ability to acquire foreign DNA, as demonstrated in experimental evolution studies

How can YhcE be exploited in protein display systems using B. subtilis cell surface?

YhcE can potentially be utilized in protein display systems:

  • Fusion protein design strategies:

    • Create chimeric proteins fusing YhcE (or portions containing membrane-spanning domains) with recombinant proteins of interest

    • Design optimal linker sequences to ensure proper folding and accessibility of the displayed protein

    • Consider domain orientation and topology to maximize surface exposure

  • Expression optimization:

    • Develop expression systems with controlled induction similar to those used for other surface display proteins

    • Balance expression levels to prevent membrane stress while achieving sufficient display

    • Optimize codon usage for efficient translation in B. subtilis

  • Comparison with established display systems:

    • Evaluate YhcE-based display against established systems using sortase-anchored proteins like YhcR

    • The YhcR sorting sequence has been successfully used to display recombinant proteins on B. subtilis cell surface, providing a benchmark for comparison

    • Assess whether YhcE membrane integration provides advantages for certain applications compared to covalent anchoring through sortases

  • Application potential:

    • Enzyme immobilization for biocatalysis

    • Development of whole-cell biosensors

    • Vaccine antigen presentation

    • Protein engineering through display-based screening

What methodologies can be used to study the potential role of YhcE in antimicrobial resistance mechanisms?

To investigate YhcE's potential role in antimicrobial resistance:

  • Antimicrobial susceptibility testing:

    • Compare minimum inhibitory concentrations (MICs) of various antibiotics between wild-type and yhcE deletion strains

    • Perform time-kill assays to assess killing kinetics

    • Evaluate whether yhcE overexpression affects antibiotic susceptibility

  • Transport assays with antimicrobial compounds:

    • Measure accumulation of fluorescent antibiotic analogs (e.g., fluorescently labeled daptomycin, vancomycin)

    • Assess efflux activity using ethidium bromide accumulation/efflux assays

    • Determine if YhcE-containing transporters can directly transport antibiotics or antibiotic-binding molecules

  • Resistance development studies:

    • Perform experimental evolution studies in the presence of antibiotics with wild-type and yhcE mutant strains

    • Determine if yhcE expression changes in response to antibiotic exposure

    • Identify potential compensatory mutations that arise in response to yhcE deletion

  • Membrane composition analysis:

    • Assess changes in membrane lipid composition in yhcE mutants

    • Evaluate membrane fluidity and permeability

    • Determine if YhcE affects the incorporation of specific membrane components that influence antibiotic susceptibility

What are the key considerations when designing antibodies for detecting and studying YhcE?

Designing effective antibodies for YhcE requires specialized approaches:

  • Epitope selection strategy:

    • Target extracellular loops between membrane-spanning domains for antibodies intended for surface labeling

    • Choose cytoplasmic domains for detecting YhcE in lysed cells or Western blots

    • Avoid hydrophobic transmembrane regions that make poor antigens

    • Use algorithms to predict antigenic regions with high surface accessibility and hydrophilicity

  • Antibody production methods:

    • For polyclonal antibodies: immunize with synthetic peptides corresponding to selected epitopes

    • For monoclonal antibodies: consider phage display technology with synthetic peptides or purified protein domains

    • Consider recombinant antibody fragments (Fab, scFv) which may have better access to constrained epitopes

  • Validation protocols:

    • Confirm specificity using yhcE deletion strains as negative controls

    • Perform preabsorption controls with immunizing peptides

    • Verify detection of YhcE-tagged fusion proteins with known epitope tags

    • Test antibody performance in multiple applications (Western blot, immunofluorescence, immunoprecipitation)

  • Application-specific considerations:

    • For live-cell labeling: use minimal antibody fragments to improve membrane penetration

    • For co-immunoprecipitation: optimize detergent conditions to maintain protein-protein interactions

    • For immunofluorescence: consider fixation methods that preserve membrane protein epitopes

What proteomics approaches are most suitable for characterizing YhcE interactions and modifications?

Advanced proteomics approaches for YhcE characterization:

  • Membrane protein-specific sample preparation:

    • Optimize detergent solubilization conditions to maintain native interactions

    • Consider alternatives like styrene-maleic acid lipid particles (SMALPs) to extract membrane proteins with their lipid environment

    • Implement careful fractionation to enrich for membrane proteins

  • Interactome analysis:

    • Proximity-dependent labeling techniques (BioID, APEX) to identify proteins in close proximity to YhcE in living cells

    • Co-immunoprecipitation coupled with mass spectrometry (MS) to identify stable interactors

    • Chemical crosslinking followed by MS (XL-MS) to map interaction interfaces

    • Quantitative comparison between wild-type and mutant conditions using SILAC or TMT labeling

  • Post-translational modification mapping:

    • Phosphoproteomics to identify regulatory phosphorylation sites

    • Glycoproteomics to detect potential glycosylation in extracellular domains

    • Identification of lipid modifications that might affect membrane localization

    • Use targeted MS approaches (parallel reaction monitoring, PRM) for low-abundance modified peptides

  • Structural proteomics:

    • Hydrogen-deuterium exchange MS to probe conformational dynamics

    • Limited proteolysis coupled with MS to identify protected regions

    • Native MS to determine oligomeric states and complex composition

    • Covalent labeling strategies to assess surface accessibility of specific residues

TechniqueApplication for YhcEAdvantagesLimitations
BioIDIn vivo interactome mappingWorks in native cellular environmentTemporal resolution limited by biotin labeling kinetics
XL-MSInteraction interface mappingCaptures transient interactionsCrosslinking chemistry biases
HDX-MSConformational dynamicsNo size limitation for proteinLower spatial resolution than crystallography
Native MSComplex compositionPreserves non-covalent interactionsRequires specialized instrumentation
PRMTargeted modification analysisHigh sensitivity for specific peptidesRequires prior knowledge of modifications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.