Recombinant Bacillus subtilis Uncharacterized protein yhgE (yhgE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bacillus subtilis Uncharacterized Protein yhgE

Recombinant Bacillus subtilis Uncharacterized Protein yhgE (UniProt ID: P32399) is a full-length protein (1–775 amino acids) expressed in Escherichia coli with an N-terminal His tag for purification . Despite its classification as "uncharacterized," it serves as a model for studying recombinant protein production in microbial hosts. The protein is produced as a lyophilized powder with >90% purity, verified via SDS-PAGE .

Primary Structure

The yhgE protein sequence contains 775 residues, including a His tag for affinity chromatography. Key features include:

  • Molecular Weight: ~89 kDa (calculated)

  • Tag: N-terminal His tag for nickel-affinity chromatography

Genomic Context

  • Gene Name: yhgE (synonyms: yixE, BSU10160, ORFB)

  • Encoding Organism: Bacillus subtilis (strain 168)

Expression System

yhgE is heterologously expressed in E. coli due to its compatibility with high-yield recombinant systems. Key parameters include:

ParameterValue/Description
Expression HostE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE confirmed)
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized water (0.1–1.0 mg/mL) with 5–50% glycerol

Challenges

Repeated freeze-thaw cycles degrade activity, necessitating aliquoting for long-term storage at –20°C or –80°C .

Hypothetical Roles

While yhgE remains uncharacterized, its sequence suggests potential roles in:

  1. Membrane-Associated Processes: Hydrophobic regions (e.g., residues 1–20) align with membrane-spanning domains.

  2. Enzymatic Activity: Conserved motifs (e.g., GXXXXGKT/S) hint at ATPase or kinase-like activity.

  3. Chaperone Function: Tandem repeats (e.g., residues 300–400) may facilitate protein folding.

Model for Expression Studies

yhgE is used to evaluate:

  • Promoter Efficiency: Testing constitutive/inducible promoters in B. subtilis .

  • Secretion Systems: Assessing Sec/Tat pathways for extracellular protein export .

  • Protease-Deficient Strains: Validating genome-reduced B. subtilis strains (e.g., IIG-Bs-27-39) for reduced proteolysis .

Fusion Protein Partner

Its full-length structure makes it suitable for tagging studies (e.g., RFP-COE fusion proteins) .

Research Gaps and Future Directions

  1. Functional Elucidation: Direct biochemical assays to determine enzymatic activity or binding partners.

  2. Structural Determination: X-ray crystallography or cryo-EM to resolve domain interactions.

  3. Biotechnological Optimization: Engineering B. subtilis strains for native yhgE secretion to avoid E. coli-specific tags .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
yhgE; yixE; BSU10160; Uncharacterized protein YhgE; ORFB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-775
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yhgE
Target Protein Sequence
MNTIRSQWKDIVTSKKLLIPIIAILFVPLIYSGVFLKAYWDPYGTVDQLPVVVVNQDKGA TYEGEKLQIGDDLVKELKDNNNFDWHFSNDLDQSLKDLLNQKYYLVVEIPEDFSKNASTV LDKNPKKLDLKYHTNAGSNYVGATIGEKAIDKLKASVSKEVTEQYTKVIFDNFKDIAKGL SDASSGAKKIDDGTKDAKNGSAQLKENLAKLKESTATISDKTAQLADGAAQVTSGIQSLD SSLGKFQDSSNQIYDKSSQLAAGSGELTSKMNELLAGLQNVQKGTPNLTNGLDQLNSKVQ EGSEKAAKAEKIINALDLTKLETAVNNLEKSETAMKEFKKQLTDFENSLKNRDQAFKNVI NSSDFLTAEQKSQLINSVEKKLPQVDAPDFDQILSQLPTADQLPDIATIKSSLEDVKAQV AQVKAMPEATSKLYNGAKTIQDAIDRLTEGADKIYNGSQKLTDGQTKLTAGIGEYNKQFA KAKAGSEQLVTGSSQVSGGLFKLLDGSKQVQSGSSKLADGSASLDTGLGKLLDGTGELSS KLKDAADQTGDIDADDQTYGMFADPVKTKDDAIHSVPNYGTGLTPYILSMGLYVGGIMLT VVFPLKEASGRPRNGFEWFFSKFNVMMLVGIIQSLIVATVLLLGIGLEVESTWRFYVFTI ITSLAFLAIIQFLATTMGNPGRFIAVIILVLQLGASGGTFPLELLPNFYQVIHGALPMTY SINGFRAVISNGDFGYMWQMAGVLIGIALVMIALSITYFTMLSRKEETSEEQPAS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal conditions for recombinant yhgE protein expression?

For effective recombinant expression of yhgE protein, E. coli has been demonstrated as a viable host system . The expression protocol typically involves:

  • Cloning the full-length yhgE gene (1-775aa) into an expression vector with an N-terminal His-tag

  • Transforming the construct into an E. coli expression strain

  • Inducing protein expression under controlled conditions

  • Harvesting and lysing cells to extract the recombinant protein

  • Purifying via affinity chromatography using the His-tag

When optimizing expression conditions, researchers should consider:

  • Induction timing (typically mid-log phase)

  • Inducer concentration

  • Post-induction incubation temperature (often lowered to 16-25°C to improve protein folding)

  • Duration of induction period

Similar approaches have been successfully applied to other B. subtilis proteins, as demonstrated in studies of genes like yaaH, where specific primers were used to amplify the gene segment from the B. subtilis chromosome for recombinant expression .

What storage conditions ensure stability of recombinant yhgE protein?

Based on established protocols for recombinant yhgE protein, the following storage recommendations should be followed:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 30-50% for long-term storage at -20°C/-80°C

  • For working aliquots, storage at 4°C is suitable for up to one week

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability during storage .

What techniques are most effective for studying the cellular localization of yhgE?

To determine the cellular localization of yhgE in B. subtilis, several complementary approaches can be employed:

  • Fluorescent protein fusion analysis:

    • Generate C- or N-terminal GFP fusion constructs with yhgE

    • Express in B. subtilis under native promoter control

    • Visualize using fluorescence microscopy to track protein localization

    This approach has been successfully used to study the localization of proteins like MreB in B. subtilis, revealing dynamic patches associated with peptidoglycan synthesis .

  • Immunolocalization with fractionation:

    • Generate antibodies against recombinant yhgE

    • Fractionate B. subtilis cells into membrane, cytosolic, and cell wall components

    • Analyze fractions by Western blotting to determine yhgE distribution

  • Bioinformatic prediction:

    • Analysis of the yhgE sequence reveals multiple transmembrane domains and membrane-associated motifs, suggesting it may be a membrane protein

Based on the amino acid sequence analysis of yhgE, which contains hydrophobic regions consistent with membrane-spanning domains, it is likely that yhgE is associated with the cell membrane. The sequence contains motifs indicative of membrane localization, particularly in the C-terminal region .

How can gene expression analysis be optimized for studying yhgE regulation?

To effectively analyze yhgE gene expression patterns and regulation, researchers should consider these methodological approaches:

  • Northern blot analysis:

    • Extract total RNA from B. subtilis cultures at different growth phases

    • Separate RNA by gel electrophoresis and transfer to membrane

    • Hybridize with labeled yhgE-specific probe

    • Quantify signal intensity to measure expression levels

    This approach has been successfully used to study the expression of genes like yaaH in B. subtilis, revealing specific temporal expression patterns during sporulation .

  • Quantitative RT-PCR:

    • Design primers specific to yhgE mRNA

    • Extract RNA from cells under various conditions

    • Perform reverse transcription followed by qPCR

    • Normalize expression to reference genes

  • Promoter fusion studies:

    • Clone the yhgE promoter region upstream of a reporter gene (e.g., lacZ)

    • Transform into B. subtilis

    • Measure reporter activity under different conditions

  • RNA-Seq analysis:

    • Perform transcriptome-wide sequencing under various conditions

    • Analyze yhgE expression levels across conditions

    • Identify co-regulated genes for functional insights

For metabolomic studies to understand yhgE function in cellular metabolism, proper sampling is critical as described in metabolome investigation protocols for B. subtilis. This includes rapid quenching of cellular metabolism to ensure the sample reflects the true biological state .

What purification strategies yield the highest purity recombinant yhgE protein?

For optimal purification of recombinant His-tagged yhgE protein, the following stepwise protocol is recommended:

  • Initial affinity chromatography:

    • Use Ni-NTA or similar metal affinity resin

    • Equilibrate column with buffer containing 10-20 mM imidazole

    • Apply cleared cell lysate

    • Wash with increasing imidazole concentrations (20-50 mM)

    • Elute with high imidazole (250-500 mM)

  • Secondary purification steps:

    • Size exclusion chromatography to remove aggregates and improve homogeneity

    • Ion exchange chromatography for removal of remaining contaminants

  • Buffer optimization:

    • Final buffer composition should typically include:

      • 50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0)

      • 150 mM NaCl

      • Optional additives: 5% glycerol, 1 mM DTT

  • Quality control assessments:

    • SDS-PAGE analysis (>90% purity expected)

    • Western blot confirmation

    • Mass spectrometry verification

The purification protocol should be optimized based on the specific properties of yhgE, which includes consideration of its predicted membrane protein characteristics and potential hydrophobic regions .

What bioinformatic approaches can predict potential functions of yhgE?

To predict the potential functions of uncharacterized proteins like yhgE, several complementary bioinformatic approaches should be employed:

  • Sequence homology analysis:

    • BLAST searches against protein databases

    • Multiple sequence alignment with putative homologs

    • Identification of conserved domains and motifs

    The yhgE protein sequence analysis suggests membrane-spanning domains, indicating it may function as a membrane transporter or receptor .

  • Structural prediction:

    • Secondary structure prediction (alpha helices, beta sheets)

    • Tertiary structure modeling using tools like AlphaFold or I-TASSER

    • Molecular dynamics simulations to predict protein behavior

  • Genomic context analysis:

    • Examination of adjacent genes in the B. subtilis genome

    • Identification of potential operons containing yhgE

    • Comparative genomics across related bacterial species

  • Protein-protein interaction prediction:

    • Analysis of potential binding partners based on structural features

    • Co-expression network analysis

    • Prediction of interaction sites using machine learning approaches

Given the current classification as an uncharacterized protein, these bioinformatic approaches represent the first step in developing hypotheses about yhgE function that can then be tested experimentally .

How can knockout or gene silencing approaches be optimized for yhgE functional studies?

For effective functional characterization of yhgE through gene inactivation, consider these methodological approaches:

  • Gene knockout strategies:

    • Homologous recombination to replace yhgE with antibiotic resistance marker

    • CRISPR-Cas9 genome editing for precise deletion

    • Construction of conditional mutants if yhgE is essential

    The natural competence of B. subtilis makes it particularly amenable to genetic manipulation through DNA uptake, facilitating these approaches .

  • Knockdown approaches:

    • Antisense RNA expression to reduce yhgE mRNA levels

    • CRISPRi (CRISPR interference) to repress yhgE transcription

    • Degradation tags for protein-level depletion

  • Phenotypic analysis of mutants:

    • Growth curves under various conditions

    • Microscopic examination of cell morphology

    • Metabolomic profiling

    • Stress resistance assays

    • Biofilm formation capacity

  • Complementation studies:

    • Reintroduction of yhgE under inducible promoter

    • Point mutants to identify critical residues

    • Domain swapping to determine functional regions

For metabolomic studies investigating the impact of yhgE deletion, proper sampling techniques are essential as described for B. subtilis metabolome investigations, including rapid quenching to preserve the cellular metabolic state .

What approaches can determine if yhgE plays a role in B. subtilis biofilm formation?

To investigate potential involvement of yhgE in biofilm formation, the following experimental approaches are recommended:

  • Biofilm assay comparisons:

    • Compare wild-type and yhgE mutant strains in static biofilm assays

    • Quantify biofilm biomass using crystal violet staining

    • Assess structural differences using confocal microscopy

    • Measure hydrophobicity changes, particularly as B. subtilis biofilms are known to be coated with the hydrophobic protein BslA

  • Gene expression analysis:

    • Monitor yhgE expression during different stages of biofilm development

    • Compare with known biofilm-associated genes

    • Perform RNA-Seq to identify co-regulated genes

  • Localization studies:

    • Track yhgE-GFP fusion proteins during biofilm formation

    • Determine if yhgE localizes to specific regions within the biofilm

    • Examine potential co-localization with matrix components

  • Complementation experiments:

    • Reintroduce yhgE under native or inducible promoters

    • Test domain-specific contributions to biofilm phenotypes

The multicellular nature of B. subtilis biofilms, with distinct cell types performing specialized functions, makes them an interesting context for studying the role of uncharacterized proteins like yhgE that may contribute to this complex developmental process .

How can protein-protein interaction studies identify yhgE binding partners?

To identify proteins that interact with yhgE and potentially elucidate its function, several complementary approaches can be employed:

  • Pull-down assays with recombinant yhgE:

    • Immobilize purified His-tagged yhgE on affinity resin

    • Incubate with B. subtilis cell lysate

    • Elute and identify binding partners by mass spectrometry

    StepBuffer CompositionConditionsNotes
    Immobilization50 mM Tris-HCl pH 8.0, 150 mM NaCl4°C, 1 hourUse 100-200 μg purified protein
    Lysate incubation50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.1% Triton X-1004°C, 2-4 hours1-5 mg total cellular protein
    WashingSame as above + 20 mM imidazole4°C, 3-5 washesRemove non-specific binding
    ElutionSame as above + 250-500 mM imidazoleRoom temp, 3-5 elutionsCollect fractions for analysis
  • Bacterial two-hybrid screening:

    • Clone yhgE into bait vector

    • Screen against B. subtilis genomic library

    • Validate positive interactions by direct testing

  • In vivo crosslinking:

    • Treat living B. subtilis cells with membrane-permeable crosslinkers

    • Purify yhgE complexes under denaturing conditions

    • Identify crosslinked partners by mass spectrometry

  • Proximity-based labeling:

    • Fuse yhgE to enzymes like BioID or APEX2

    • Express in B. subtilis to label proximal proteins

    • Purify and identify labeled proteins

These approaches can leverage the extensive knowledge of protein-protein interactions in B. subtilis and help place yhgE within known cellular pathways .

What mass spectrometry approaches are optimal for studying yhgE post-translational modifications?

To characterize potential post-translational modifications (PTMs) of yhgE protein, the following mass spectrometry approaches are recommended:

  • Sample preparation protocols:

    • In-gel digestion of purified yhgE with multiple proteases (trypsin, chymotrypsin)

    • Enrichment strategies for specific PTMs (phosphopeptides, glycopeptides)

    • Fractionation to increase coverage of modified peptides

  • MS analysis strategies:

    • High-resolution LC-MS/MS using Orbitrap or Q-TOF instruments

    • Data-dependent acquisition (DDA) for discovery-based approaches

    • Parallel reaction monitoring (PRM) for targeted analysis of suspected modifications

    • Electron transfer dissociation (ETD) to preserve labile modifications

  • Data analysis workflow:

    • Database searches with variable modification parameters

    • Manual validation of PTM-containing spectra

    • Quantification of modification stoichiometry

    • Site localization scoring

  • Temporal and condition-specific analysis:

    • Compare yhgE modifications across growth phases

    • Examine PTM changes during stress responses

    • Correlate modifications with functional states

For metabolomic studies involving yhgE, proper sampling techniques as described for B. subtilis studies should be employed to preserve the cellular state during analysis .

How can structural biology techniques be applied to uncharacterized proteins like yhgE?

For elucidating the structure of yhgE and gaining functional insights, multiple structural biology approaches should be considered:

  • X-ray crystallography:

    • Expression and purification optimization for crystallization

    • Screening of crystallization conditions

    • Data collection and structure determination

    • For membrane proteins like yhgE, detergent screening is critical

  • Cryo-electron microscopy:

    • Sample preparation for single-particle analysis

    • Image acquisition on high-resolution microscopes

    • 3D reconstruction and model building

    • Particularly valuable for membrane proteins that resist crystallization

  • NMR spectroscopy:

    • Isotopic labeling (15N, 13C) of recombinant yhgE

    • Acquisition of multidimensional spectra

    • Structure calculation from distance restraints

    • Dynamics analysis for flexible regions

  • HDX-MS (Hydrogen-Deuterium Exchange):

    • Probe solvent accessibility and conformational dynamics

    • Identify stable domains and flexible regions

    • Monitor structural changes upon ligand binding

  • Integrative structural biology:

    • Combine multiple techniques (low-resolution EM, SAXS, crosslinking-MS)

    • Computational modeling to integrate diverse data

    • Molecular dynamics simulations to study protein behavior

Understanding the structure of yhgE would provide significant insights into its potential function, particularly given its predicted membrane localization and potential role in transport or signaling .

How might understanding yhgE function contribute to biotechnological applications of B. subtilis?

B. subtilis is widely used as a biotechnology workhorse due to its ability to secrete large amounts of proteins and produce various commercially valuable compounds . Understanding yhgE function could contribute to these applications in several ways:

  • Protein secretion enhancement:

    • If yhgE is involved in membrane dynamics or transport, its manipulation could potentially improve recombinant protein secretion

    • Optimization of expression conditions based on yhgE function

    • Engineering of yhgE variants with enhanced capabilities

  • Metabolic engineering:

    • Integration of yhgE function into metabolic models of B. subtilis

    • Potential manipulation to enhance production of valuable metabolites

    • Creation of optimized strains for biotechnological applications

  • Biofilm-based applications:

    • If yhgE plays a role in biofilm formation, it could be targeted to develop biofilm-based technologies

    • Applications in bioremediation, biocatalysis, or biomaterial production

    • B. subtilis biofilms display remarkable properties, including extreme water repellence that could be exploited industrially

  • Probiotic development:

    • B. subtilis has potential probiotic applications

    • Understanding yhgE's role could contribute to developing strains with enhanced probiotic properties

    • Targeted modifications for specific health applications

For these biotechnological applications, understanding the metabolic context of yhgE function would be valuable, requiring appropriate metabolome investigation techniques as described for B. subtilis studies .

What experimental approaches can test if yhgE is involved in B. subtilis spore formation?

To investigate potential involvement of yhgE in the complex sporulation process of B. subtilis, the following methodological approaches are recommended:

  • Temporal expression analysis:

    • Monitor yhgE expression throughout sporulation using RT-qPCR

    • Compare with known sporulation-specific genes

    • Determine if expression is controlled by sporulation-specific sigma factors like SigE, SigF, SigG, or SigK

    This approach has been successfully used for other B. subtilis genes like yaaH, which was found to be regulated by SigE during sporulation .

  • Sporulation efficiency testing:

    • Compare sporulation frequencies between wild-type and yhgE mutants

    • Microscopic examination of sporulation stages

    • Analysis of resistance properties of the resulting spores

  • Localization during sporulation:

    • Track yhgE-GFP fusion proteins during sporulation

    • Determine compartment-specific localization (mother cell vs. forespore)

    • Co-localization with known sporulation proteins

  • Genetic interaction studies:

    • Construct double mutants with known sporulation genes

    • Epistasis analysis to place yhgE in the sporulation genetic pathway

    • Complementation with sporulation stage-specific expression

The sophisticated genetic program controlling B. subtilis sporulation, involving multiple sigma factors and complex regulatory mechanisms, provides a well-characterized context for studying potential roles of yhgE in this developmental process .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.