Recombinant Bacillus subtilis Uncharacterized protein yitM (yitM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yitM; BSU11040; Uncharacterized protein YitM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-194
Protein Length
Full Length of Mature Protein
Species
Bacillus subtilis (strain 168)
Target Names
yitM
Target Protein Sequence
KQLEYSGEEIFKGFVFAQGEVGKQLPEVFNKAMTDKLNTKQAKAFANQVVADIKKEDADF FDNLKKAVYSKDALKVDELLKKAGQIVEEKVEAAKEIAASKDDTSRVQAELVNTVDTANY FYYVSYVAAAGALILIILAIDITPIAISDNVDREMAIRTLVDELN
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the yitM protein and what is its relation to other proteins in B. subtilis?

The yitM protein is part of the yitPOM operon in Bacillus subtilis, which functions as a paralog of the sdpABC operon. While SdpABC produces the secreted peptide toxin SDP, the yitPOM operon encodes proteins that lead to the production of the YIT toxin. YitM has an N-terminal secretion signal similar to SdpC, though sequence similarity is limited to the N-terminal three-quarters of the protein. Notably, YitM's C-terminal region contains a hydrophobic domain that may be processed to form the secreted YIT toxin .

How is the yitPOM operon regulated in B. subtilis?

Unlike the sdpABC operon, the yitPOM operon is specifically induced in biofilms through the DegS-DegU two-component regulatory system. High expression of yitPOM leads to the production of the secreted YIT toxin. This biofilm-specific regulation suggests a specialized role in bacterial community dynamics .

What is known about the structural characteristics of yitM?

The yitM protein contains an N-terminal secretion signal and a C-terminal hydrophobic domain. While the C-terminal region has no direct sequence similarity to the SDP toxin, the structural presence of the hydrophobic domain suggests functional similarity in toxin processing. YitP and YitO exhibit approximately 50% sequence similarity to the entire SdpA and SdpB sequences respectively, indicating conserved mechanisms within these paralogous systems .

What expression systems are typically used for recombinant production of B. subtilis proteins?

For recombinant expression of B. subtilis proteins like yitM, E. coli expression systems are commonly employed. This heterologous expression approach allows for the production of sufficient quantities of protein for research purposes. As demonstrated with other B. subtilis proteins such as YDHD, expression in E. coli with affinity tags (like His-tags) facilitates purification through standardized methods .

How does the YIT toxin system differ from conventional antibiotics in biofilm penetration?

The YIT toxin demonstrates a remarkable ability to penetrate biofilm matrices, unlike many conventional antibiotics whose diffusion is hindered by extracellular polymeric substances. Research indicates that the YIT toxin, in coordination with the extracellular neutral protease NprB, can effectively pass through layers of biofilm matrix polymers to target cells within established biofilms. This property makes the YIT toxin system a potential model for developing anti-biofilm agents that can overcome the protective matrix barrier .

What are the experimental approaches to study yitM processing and toxin production?

Investigating yitM processing requires a comprehensive strategy focusing on post-translational modifications. Current research suggests that YitM's C-terminal hydrophobic domain might be processed via a YitP and YitO-dependent mechanism to produce the secreted YIT toxin. Experimental approaches would include:

  • Protein expression analysis using SDS-PAGE and western blotting to detect processing products

  • Mass spectrometry to identify the exact cleavage sites and toxin sequences

  • Mutation studies targeting potential processing sites

  • Heterologous expression systems with controlled induction to monitor toxin production

Researchers should consider implementing a proteomics approach to track the processing events from the full-length YitM to the mature YIT toxin .

What is the relationship between YIT toxin resistance, SigW, and YitQ?

Expression of yitQ, which lies upstream of yitPOM, confers resistance to the YIT toxin, suggesting YitQ functions as an anti-toxin protein. Additionally, the alternative sigma factor SigW contributes to YIT toxin resistance through a separate mechanism. In mutants lacking both yitQ and sigW, the YIT toxin specifically inhibits biofilm formation, indicating a dual protection system. This complex resistance mechanism involves membrane proteins and transcriptional regulation, providing multiple layers of protection against self-intoxication .

How can genetic code expansion techniques be applied to study yitM function?

Genetic code expansion in B. subtilis allows for the incorporation of non-standard amino acids (nsAAs) within proteins like yitM. This approach can be particularly valuable for studying protein-protein interactions and functional domains within yitM through:

  • Incorporating photocrosslinking nsAAs to capture transient interactions with processing enzymes or target molecules

  • Using click-chemistry compatible nsAAs to label yitM for visualization and tracking

  • Employing nsAAs for translational titration to precisely control yitM expression levels

  • Introducing nsAAs at potential processing sites to investigate cleavage mechanisms

The availability of diverse synthetases in B. subtilis capable of incorporating up to 20 different nsAAs makes this approach highly versatile for yitM functional studies .

What are the optimal conditions for recombinant expression of yitM?

For recombinant expression of yitM, researchers should consider the following conditions:

ParameterRecommended ConditionNotes
Expression HostE. coli BL21(DE3)Alternative hosts like B. subtilis may be used for native-like processing
Induction SystemIPTG-inducible promoter (0.5-1.0 mM)Lower concentrations may increase solubility
Growth Temperature18-25°C post-inductionLower temperatures often improve folding of membrane-associated proteins
Growth MediaLB with appropriate antibioticsRich media may improve yield
Affinity TagN-terminal His-tagC-terminal tags may interfere with processing
Buffer CompositionPBS with mild detergentsConsider including protease inhibitors to prevent degradation

It's important to note that expression conditions should be optimized empirically, as the hydrophobic domains in yitM may affect solubility and proper folding .

How can researchers effectively study yitM's role in biofilm formation?

To investigate yitM's role in biofilm formation, researchers should implement a multi-faceted approach:

  • Generate precise genetic constructs:

    • yitM deletion mutants

    • Strains with controlled expression of yitM (using inducible promoters)

    • Fluorescently tagged yitM for localization studies

  • Employ biofilm assays:

    • Static biofilm formation in microtiter plates

    • Flow cell systems for dynamic biofilm formation

    • Confocal microscopy with fluorescent matrix stains

    • Quantification of biofilm biomass, thickness, and architecture

  • Study competitive interactions:

    • Co-culture experiments with wild-type and YIT-sensitive mutants

    • Spatial organization analysis within mixed biofilms

    • Quantification of strain ratios using fluorescent markers

  • Analyze matrix interactions:

    • Examine interactions between YIT toxin and biofilm matrix components

    • Test the role of NprB in facilitating toxin penetration through the matrix

    • Study the effects of overexpression of matrix polymers on toxin activity

What purification strategies are recommended for obtaining active recombinant yitM?

Purification of recombinant yitM requires careful consideration of its membrane-associated properties and potential processing:

Purification StepMethodConsiderations
Cell LysisGentle methods (e.g., sonication with cooling)Avoid excessive heat that may denature the protein
Initial CaptureIMAC (Immobilized Metal Affinity Chromatography)Use His-tag for efficient capture
Intermediate PurificationIon Exchange ChromatographyConsider predicted pI for optimal conditions
PolishingSize Exclusion ChromatographyUseful for separating monomeric from aggregated forms
Buffer OptimizationDetergent screeningMild detergents like DDM or CHAPS may help maintain native structure
Quality ControlSDS-PAGE and Western BlottingCheck for degradation or processing products

Researchers should consider including stability tests under various conditions to determine optimal storage parameters for maintaining activity .

How should researchers analyze sequence data to predict functional domains in yitM?

Analysis of yitM sequence data should incorporate multiple bioinformatic approaches to identify functional domains:

  • Comparative sequence analysis:

    • Align yitM with SdpC and other related proteins

    • Identify conserved and divergent regions

    • Focus on the C-terminal hydrophobic domain that may form the active toxin

  • Structural prediction:

    • Use protein structure prediction tools to model potential toxin domains

    • Analyze hydrophobicity plots to identify membrane-interacting regions

    • Predict potential processing sites based on protease recognition motifs

  • Evolutionary analysis:

    • Compare yitM across different Bacillus species to identify conserved elements

    • Conduct phylogenetic analysis to understand evolutionary relationships with other toxin systems

Based on current data, researchers should pay particular attention to the C-terminal hydrophobic domain of yitM, which might be processed to form the secreted YIT toxin despite lacking sequence similarity to the SDP toxin region .

What approaches are useful for analyzing yitM expression patterns in different growth conditions?

To effectively analyze yitM expression patterns, researchers should consider:

  • Transcriptomic analysis:

    • RNA-seq to quantify yitPOM operon expression under various conditions

    • qRT-PCR to validate expression levels and examine regulation

    • Promoter-reporter fusions to visualize expression patterns in real-time

  • Proteomic analysis:

    • Western blotting to detect yitM protein levels

    • Mass spectrometry to identify post-translational modifications

    • Pulse-chase experiments to determine protein turnover rates

  • Condition matrix testing:

    • Examine expression during biofilm formation versus planktonic growth

    • Test the effect of DegS-DegU system activation on expression

    • Investigate competitive conditions with other bacterial species

The regulation by the DegS-DegU two-component system suggests that researchers should focus on biofilm conditions and potentially stress responses to understand the contextual expression of yitM .

How can researchers distinguish between direct effects of YIT toxin and secondary cellular responses?

Distinguishing primary effects of the YIT toxin from secondary cellular responses requires carefully designed experiments:

  • Time-course studies:

    • Monitor cellular responses at short intervals after toxin exposure

    • Early events are more likely to represent direct toxin effects

  • Dose-response experiments:

    • Test multiple concentrations of purified toxin

    • Direct effects typically show clearer dose-dependence

  • Genetic approaches:

    • Create a panel of resistant mutants to identify targets

    • Use transcriptomics to identify immediate response genes

  • Cell biology techniques:

    • Fluorescently labeled toxin to track subcellular localization

    • Membrane permeability assays to assess direct damage

  • Biochemical assays:

    • In vitro interaction studies with purified components

    • Target validation through reconstitution experiments

Current research indicates that in biofilms, distinguishing the cooperative action of the YIT toxin and NprB protease is particularly important, as the protease appears to facilitate toxin activity specifically within the biofilm context .

What are the promising applications of the YIT toxin system in anti-biofilm research?

The YIT toxin system offers unique properties that could advance anti-biofilm strategies:

  • Drug delivery models:

    • The YIT toxin's ability to penetrate biofilm matrices could inform the design of delivery systems for conventional antibiotics

    • Cooperative action with NprB suggests potential combination therapies targeting both matrix integrity and cellular viability

  • Synthetic biology applications:

    • Engineered YIT toxin variants with modified specificities

    • Development of controllable biofilm dispersal systems based on the YIT mechanism

  • Biofilm composition control:

    • Using modified YIT systems to selectively target specific bacterial populations within mixed-species biofilms

    • Applications in microbiome engineering and biofilm community structure manipulation

The ability of YIT toxin to pass through biofilm matrix polymers with assistance from NprB represents a natural solution to the challenge of biofilm penetration that could inspire new therapeutic approaches .

How might genetic code expansion in B. subtilis enhance studies of yitM and related proteins?

Genetic code expansion offers powerful tools for investigating yitM function:

Non-standard Amino Acid ApplicationResearch BenefitExample Methodology
Click Chemistry-compatible nsAAsIn vivo labeling and visualizationIncorporate azide or alkyne nsAAs for fluorophore conjugation
Photocrosslinking nsAAsCapture transient protein interactionsUse Bpa or AzF to identify binding partners during processing
Metal-chelating nsAAsStudy metal ion dependenciesIncorporate amino acids that can coordinate metal ions
Fluorescent nsAAsDirect visualization without tagsMonitor localization without bulky fluorescent proteins
Translational titrationPrecise control of expression levelsFine-tune yitM levels to determine threshold effects

The established genetic code expansion systems in B. subtilis, which can incorporate up to 20 distinct non-standard amino acids, provide versatile tools for studying protein processing, interactions, and function in their native context .

What are the key insights researchers should consider when working with recombinant yitM?

When working with recombinant yitM, researchers should consider:

  • The dual nature of yitM as both a structural protein and a potential toxin precursor

  • The importance of the processing pathway involving YitP and YitO

  • The biofilm-specific regulation through the DegS-DegU two-component system

  • The cooperative action with NprB protease for effective biofilm penetration

  • The protective mechanisms involving YitQ and SigW that prevent self-intoxication

Understanding these aspects will help researchers design appropriate experimental systems and interpret results in the context of B. subtilis biology and bacterial competition strategies .

How does research on yitM contribute to our broader understanding of bacterial competition and biofilm dynamics?

Research on yitM and the YIT toxin system enhances our understanding of:

  • Specialized adaptations for competition within biofilm environments

  • Mechanisms for penetrating biofilm matrix barriers

  • Coordinated action between toxins and extracellular enzymes

  • Evolution of paralogous systems with specialized functions

  • Self-protection strategies in toxin-producing bacteria

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.