Recombinant Bacillus subtilis Uncharacterized protein yjcP (yjcP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yjcP; BSU11940; Uncharacterized protein YjcP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yjcP
Target Protein Sequence
MKKQKNNKKKNIEKRNIEKRNIEEKNNEDLEELENAIYTYHKKELLAFFLEKTRIGHDKE EYKRFQSLLYKLDIECLEFAISRFSHIDIIHDHSKYVPAFIPLFAAYLTMFFNFYEKHWG ALSFAAGTIAAIVWIIAVERKHRNQAISIMKIFEQVKERKVKDRSKD
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the fundamental approaches to characterize an uncharacterized protein like yjcP in Bacillus subtilis?

Characterization of uncharacterized proteins like yjcP typically follows a systematic approach:

  • Genomic context analysis: Examine neighboring genes to infer possible function. For yjcP, analyze its proximity to known gene clusters such as the cotVWXYZ cluster, which could suggest involvement in sporulation processes similar to yjcC (now renamed spoVIF) .

  • Transcriptional profiling: Determine when the gene is expressed using Northern blot analysis or RNA-seq. This reveals temporal expression patterns during growth phases or sporulation stages (t₀-t₆).

  • Sigma factor dependency: Identify which sigma factors control expression. In Bacillus subtilis, sporulation-specific genes are often regulated by SigE (early mother cell), SigK (late mother cell), SigF (early forespore), or SigG (late forespore) .

  • Insertional inactivation: Generate knockout mutants to observe phenotypic changes in growth, sporulation efficiency, and spore properties.

  • Recombinant expression: Clone and express the protein to study its biochemical properties and interactions.

How can bioinformatics predict the function of uncharacterized proteins like yjcP?

Bioinformatic analyses provide valuable insights through:

Primary sequence analysis:

  • Identify conserved domains using tools like NCBI Conserved Domain Database

  • Detect functional motifs and catalytic sites

  • Calculate basic physicochemical properties (molecular weight, pI, GRAVY score)

Structural prediction:

  • Secondary structure prediction

  • 3D structure modeling through homology modeling or ab initio approaches

  • Binding site prediction for potential ligands or interaction partners

Comparative genomics:

  • Ortholog identification across bacterial species

  • Synteny analysis to identify conservation of genomic context

Bioinformatics ApproachToolsPrimary Information Obtained
Sequence homologyBLAST, HMMERPotential homologs, conserved regions
Domain predictionPfam, SMART, CDDFunctional domains
Subcellular localizationPSORTb, SignalPProtein destination
Structural predictionAlphaFold, I-TASSER3D structure model
Genomic contextString, GeConTFunctional associations

These approaches have successfully annotated numerous hypothetical proteins in bacterial systems, providing insights into their potential functions .

What techniques are most reliable for experimental verification of yjcP expression in Bacillus subtilis?

Reliable experimental verification requires multiple complementary approaches:

Transcriptional analysis:

  • RT-PCR: Confirms gene expression

  • Northern blotting: Identifies transcript size and operon structure

  • Promoter-reporter fusions (lacZ, gfp): Maps promoter activity and temporal expression

Protein detection:

  • Western blotting: Requires specific antibodies against the protein

  • Mass spectrometry: Confirms protein presence and potential modifications

Expression timing:
For sporulation-related proteins like potentially yjcP, sampling must occur at specific time points. In Bacillus subtilis, genes are often categorized based on their time of expression during sporulation (t₀-t₆) .

The most conclusive approach combines transcriptional analysis with protein detection, coupled with phenotypic analysis of deletion mutants.

How should researchers design knockout experiments to determine the role of yjcP in Bacillus subtilis?

Designing effective knockout experiments requires:

Knockout strategy selection:

  • Insertional inactivation: Using integration vectors like pMUTIN plasmids

  • Clean deletion: Using marker replacement with subsequent marker removal

  • CRISPR-Cas9: For precise genomic editing

Validation methods:

  • PCR verification of correct integration/deletion

  • RT-PCR to confirm absence of transcript

  • Complementation studies to confirm phenotype causality

Phenotypic analyses:

  • Growth curves in different media conditions

  • Sporulation efficiency quantification

  • Spore resistance properties (heat, lysozyme, chemicals)

  • Microscopic examination of sporulation stages and spore coat integrity (as seen with yjcC/spoVIF mutants)

  • Transcriptome analysis to identify affected pathways

Experimental design considerations:

  • Include appropriate controls (wild-type, complemented strains)

  • Test multiple environmental conditions (nutrient limitation, stress)

  • Examine potential redundancy through double/multiple knockouts

For yjcP, special attention should be given to sporulation phenotypes, as many uncharacterized proteins in Bacillus subtilis play roles in this complex developmental process .

What methodological approaches can determine if yjcP functions within a two-component regulatory system?

Two-component systems are abundant in Bacillus subtilis, with 36 sensor kinases and 35 response regulators identified . To determine if yjcP functions within such a system:

Sequence analysis:

  • Search for characteristic domains (histidine kinase, response regulator, receiver domains)

  • Identify phosphorylation sites

  • Examine for DNA-binding domains

Genetic approaches:

  • Construct strains overexpressing yjcP to identify potential regulon members

  • Create phosphomimetic mutants to simulate activated/deactivated states

  • Perform epistasis studies with known regulatory systems

Biochemical methods:

  • In vitro phosphorylation assays

  • Phosphotransfer experiments with candidate partner proteins

  • DNA-binding assays if a DNA-binding domain is present

Transcriptomic studies:

  • Perform DNA microarray or RNA-seq analyses comparing wild-type and mutant strains

  • Identify differentially expressed genes in response to specific stimuli

As seen in studies of other two-component systems, comprehensive DNA microarray analysis can reveal the extensive regulons controlled by these systems and their roles in cellular processes .

What structural biology techniques are most appropriate for characterizing the three-dimensional structure of yjcP?

Structural characterization requires:

Sample preparation:

  • Optimize expression conditions (strain, temperature, induction)

  • Develop purification protocols (affinity tags, chromatography steps)

  • Verify protein homogeneity (size-exclusion chromatography, dynamic light scattering)

Structural techniques:

  • X-ray crystallography: Requires protein crystallization

  • Nuclear Magnetic Resonance (NMR): For smaller proteins (<30 kDa)

  • Cryo-Electron Microscopy: Especially for membrane proteins or complexes

  • Small-Angle X-ray Scattering (SAXS): For low-resolution envelope

Computational approaches:

  • Homology modeling if structural homologs exist

  • Ab initio structure prediction using AlphaFold or similar tools

  • Molecular dynamics simulations to study flexibility and conformational changes

Functional structural studies:

  • Site-directed mutagenesis of predicted functional residues

  • Ligand binding studies using isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR)

  • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

The choice of method depends on protein size, stability, quantity obtainable, and presence of structural homologs.

How can researchers effectively determine if yjcP is involved in the sporulation process of Bacillus subtilis?

Sporulation in Bacillus subtilis involves a complex genetic program with distinct morphological stages. To investigate yjcP's potential role:

Temporal expression analysis:

  • Monitor yjcP expression throughout sporulation using quantitative RT-PCR

  • Determine sigma factor dependency (SigE, SigK for mother cell genes; SigF, SigG for forespore genes)

  • Identify potential regulatory elements (GerE-binding sites seen with other sporulation genes)

Morphological examination:

  • Phase-contrast microscopy to monitor sporulation progression

  • Transmission electron microscopy to examine spore ultrastructure

  • Fluorescence microscopy with protein fusions to track localization

Spore property analysis:

  • Measure resistance to heat, chemicals, and lysozyme

  • Quantify germination efficiency

  • Examine coat protein assembly (as yjcC/spoVIF is involved in coat assembly)

Molecular interactions:

  • Identify protein-protein interactions with known sporulation proteins

  • Perform chromatin immunoprecipitation if DNA-binding activity is suspected

Sporulation StageMorphological FeaturesPotential yjcP Role Assessment Methods
Stage 0Pre-divisional cellMonitor expression onset
Stage IIAsymmetric septationLocalization studies, septum formation analysis
Stage IIIEngulfmentMembrane tracking, σᴳ/σᴱ activity
Stage IVCortex formationPeptidoglycan synthesis analysis
Stage VCoat formationCoat protein assembly, EM analysis
Stage VIMaturationResistance properties, similar to yjcC/spoVIF

This systematic approach would parallel the successful characterization of yjcC (renamed spoVIF) which was found to be transcribed by SigK RNA polymerase beginning at t₄ of sporulation and involved in spore coat assembly .

What approaches can identify potential protein-protein interactions of yjcP?

Identifying interaction partners requires complementary techniques:

In vivo approaches:

  • Bacterial two-hybrid systems

  • Co-immunoprecipitation followed by mass spectrometry

  • Fluorescence resonance energy transfer (FRET)

  • Split-GFP complementation assay

In vitro methods:

  • Pull-down assays with purified recombinant proteins

  • Surface plasmon resonance (SPR)

  • Isothermal titration calorimetry (ITC)

  • Chemical cross-linking coupled with mass spectrometry

Computational predictions:

  • Text mining of scientific literature

  • Co-expression analysis

  • Genomic context methods

  • Structural docking

For bacterial systems like Bacillus subtilis, special attention should be given to interactions that might occur during specific developmental stages such as sporulation, as many proteins function in multi-component complexes during this process .

How can comparative genomics be used to infer the function of yjcP?

Comparative genomics provides evolutionary context through:

Ortholog identification:

  • Search for yjcP orthologs across bacterial species

  • Analyze conservation patterns, particularly within Bacillus species

  • Examine gene neighborhood conservation

Phylogenetic profiling:

  • Correlate presence/absence patterns with specific traits

  • Identify co-evolved gene sets

Synteny analysis:

  • Map gene order conservation

  • Identify operonic structures

Evolutionary rate analysis:

  • Calculate selection pressure (dN/dS ratios)

  • Identify conserved residues under purifying selection

This approach has been successfully applied to characterize various hypothetical proteins, as seen in the systematic functional analysis of the Bacillus subtilis genome .

What transcriptomic and proteomic methodologies would best reveal the regulatory network involving yjcP?

To decipher regulatory networks:

Transcriptomic approaches:

  • RNA-seq under various conditions and in different genetic backgrounds

  • ChIP-seq if yjcP has DNA-binding properties

  • Time-course analysis during developmental processes

Proteomic methods:

  • Global protein expression profiling

  • Phosphoproteomics to detect signaling events

  • Protein turnover analysis

Network construction:

  • Co-expression network analysis

  • Transcription factor binding site prediction

  • Regulatory motif discovery

Validation strategies:

  • Reporter gene assays for predicted regulatory targets

  • Electrophoretic mobility shift assays for direct DNA interactions

  • Targeted gene expression analysis by qRT-PCR

These approaches are particularly important for understanding the role of uncharacterized proteins in complex cellular processes, as demonstrated in the comprehensive analysis of two-component regulatory systems in Bacillus subtilis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.