Recombinant Bacillus subtilis Uncharacterized protein yknW (yknW)

Shipped with Ice Packs
In Stock

Description

Functional Role in the YknWXYZ Transporter Complex

YknW is a critical component of the YknWXYZ complex, an atypical four-component ATP-binding cassette (ABC) transporter. Key functional insights:

  • Complex Assembly:

    • YknW stabilizes interactions between YknX (a membrane fusion protein) and YknYZ (ATPase-permease subunits), forming a functional transporter .

    • Chemical cross-linking experiments confirm YknW’s role in modulating YknX oligomerization and complex stability .

  • Toxin Resistance:

    • Confers protection against the endogenous toxin SDP (sporulation-delaying protein). Overexpression of YknW alone provides partial resistance, while full protection requires all four components (YknWXYZ) .

    • Independent of SdpC (the SDP toxin precursor), indicating a constitutive defense mechanism .

Gene Expression and Regulation

  • The yknWXYZ operon is constitutively expressed during B. subtilis growth, independent of σᴡ regulon induction or SDP toxin presence .

  • Deletion of yknW disrupts downstream yknXYZ expression, suggesting transcriptional coupling within the operon .

Interaction Studies

  • Copurification Assays: YknW binds directly to the YknXYZ subcomplex, though it does not form stable cross-linked adducts with individual subunits .

  • Functional Complementation: Plasmid-driven expression of YknW restores partial SDP resistance in yknW-deficient strains .

Applications and Implications

  • Antimicrobial Research: YknWXYZ serves as a model for studying four-component ABC transporters, which are rare in Gram-positive bacteria .

  • Biotechnological Potential: Recombinant YknW enables structural studies (e.g., crystallography) to elucidate mechanisms of toxin efflux .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yknW; BSU14340; Membrane protein YknW
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yknW
Target Protein Sequence
METNVEKNSGTATEKPSLFGVITSPSVQFERIRERPAVWGPLLIVAAIIIVGAVLQSLGT DYSELLKSQDTQGLSAEQMETVATITKFGGMAGAIIGGIAALFIAPLIYWLCVKVSGGVT TYKKMLSLSLFVSLISSLGLLVNGIVAFTTDVNPLYSTTSLAGIIPSDGALASVLNTFEI FSIWSFVLLAIGLHKTGGISKKAGWISAIILFGILVVFSLFSGLINSVAGA
Uniprot No.

Target Background

Function

Recombinant Bacillus subtilis Uncharacterized protein yknW (yknW) is part of an unusual four-component transporter. It plays a crucial role in protecting against the killing factor SdpC (sporulation-delaying protein) and is involved in the assembly of the YknXYZ complex.

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the YknW protein in Bacillus subtilis and how is it characterized?

YknW is a membrane protein with four putative transmembrane segments that belongs to the Yip1 family of proteins, which in eukaryotic cells interact with Rab GTPases for vesicular transport . In B. subtilis, YknW is the first gene in the yknWXYZ operon, which encodes a four-component ATP-binding cassette (ABC) export complex . While the three other proteins (YknX, YknY, and YknZ) have been characterized as homologs of macrolide efflux transporters, YknW represents a unique component whose function remained largely unknown until recent investigations . Secondary structure predictions and membrane protein analyses confirm YknW's integration into the cytoplasmic membrane, where it appears to function as part of a transport system involved in antimicrobial stress responses .

What is the evolutionary conservation pattern of YknW across bacterial species?

YknW is highly conserved in Bacillus species and their close relatives but notably absent from genomes of many Gram-positive and Gram-negative bacteria . This restricted distribution pattern suggests that YknW may serve a specialized function in Bacillus and closely related genera. The conservation of YknW within Bacillus contrasts with the broader distribution of YknXYZ homologs, such as MacAB from Escherichia coli, which are widely found across various bacterial species . Researchers interested in YknW's evolutionary significance should consider comparative genomic approaches to identify conserved domains and potential functional motifs across Bacillus species, which could provide insights into its specialized role in these organisms.

What experimental approaches can be used to study YknW's interactions with other components of the YknWXYZ complex?

Several complementary experimental approaches have proven effective for investigating YknW's interactions with other components of the YknWXYZ complex:

  • Chemical Cross-linking: Treatment of intact cells with dithiobis(succinimidyl propionate) (DSP) has been successfully used to stabilize protein-protein interactions in vivo . This approach showed that while YknW alone did not form detectable complexes, its presence altered the cross-linking profile of YknX, suggesting it modulates YknX-containing complexes .

  • Affinity Purification: Attachment of 6His affinity tags to YknW, YknX, or YknZ enables purification of protein complexes using metal affinity chromatography . This method revealed that YknW purifies as oligomers (dimers and tetramers) and influences the oligomeric state of purified YknX .

  • Membrane-Mixing Experiments: Mixing membrane proteins from cells producing different components of the complex can help identify stable interactions . In these experiments, equal amounts of membrane proteins from cells producing YknX-His, YknYZ-His, or YknXYZ-His are mixed with membrane proteins from cells expressing untagged YknW .

  • Immunoblotting Analysis: Using specific antibodies against YknW and YknX has been effective for detecting these proteins in purified complexes and analyzing their oligomeric states .

How can researchers purify and characterize recombinant YknW protein?

The purification and characterization of recombinant YknW requires specialized approaches for membrane proteins:

Table 1: Methodology for YknW Purification and Characterization

StepProcedureTechnical Considerations
Expression SystemUse pHCMC04 plasmid with xylose-inducible promoter in B. subtilis HB6127 (yknWXYZ::Kan)Induction with 0.5% xylose for 3 hours at OD₆₀₀ ~0.5
Cell HarvestingCentrifugation at 3,440 × g for 20 minutes at room temperatureResuspend in 0.1 M sodium phosphate buffer (pH 7.0)
Membrane IsolationUltracentrifugation following cell lysisCritical to separate cytoplasmic and membrane fractions
Protein SolubilizationUse appropriate detergents for membrane protein extractionDetergent choice affects protein stability and activity
Affinity PurificationMetal affinity chromatography using C-terminal 6His tagYknW purifies as oligomers (monomers, dimers, tetramers)
VisualizationSDS-PAGE with Coomassie brilliant blue staining and immunoblottingAnti-YknW and anti-6His antibodies for confirmation
Oligomerization AnalysisChemical cross-linking with DSP followed by SDS-PAGEYknW forms stable dimers and tetramers after purification

What functional assays demonstrate YknW's role in SDP resistance?

Several complementary assays have been used to demonstrate YknW's role in providing resistance against the SDP toxin:

  • Plasmid Complementation Assays: Researchers introduced plasmids expressing different combinations of YknW, YknX, YknYZ into B. subtilis strains lacking the yknWXYZ genes . This approach showed that while YknW alone provides partial protection against SDP toxin, all four YknWXYZ proteins are required for full protection against both endogenous and exogenous SDP .

  • Growth Inhibition Assays: These assays measure bacterial growth in the presence of SDP toxin, comparing wild-type, deletion mutants, and complemented strains . Results demonstrated that YknW contributes to SDP resistance, but the complete YknWXYZ complex is necessary for full protection .

  • RT-PCR Analysis: This technique confirmed expression of yknY and yknZ genes from plasmid constructs, ensuring that observed phenotypes were not due to lack of expression .

  • Cross-resistance Testing: Assessing whether YknW or YknWXYZ provide resistance to other antimicrobial compounds besides SDP can illuminate the specificity of this protection mechanism .

How does the oligomerization state of YknW affect its function in the YknWXYZ complex?

YknW has been observed to form oligomers, specifically dimers and tetramers, that can be isolated during protein purification . These oligomeric forms were stabilized during purification on Cu²⁺ affinity columns, although high-molecular-weight species reacting specifically with anti-YknW antibodies were not detected in intact B. subtilis membranes . This suggests that YknW oligomerization may be influenced by experimental conditions or may occur dynamically in vivo.

Researchers investigating the relationship between YknW oligomerization and function should consider site-directed mutagenesis approaches targeting putative oligomerization interfaces, followed by functional assays for SDP resistance and complex assembly.

What is the mechanistic basis for YknW-dependent modulation of YknXYZ complex assembly?

YknW appears to play a crucial role in modulating the assembly of the YknXYZ complex, though the precise molecular mechanism remains to be fully characterized. Several key observations provide insights into this process:

How does the YknWXYZ transporter complex function in the context of bacterial stress responses?

The YknWXYZ transporter complex functions as part of B. subtilis' response to antimicrobial stress, particularly in providing protection against the endogenous toxin SDP . The complex represents an unusual four-component transporter with a specialized role in the starvation-induced killing of B. subtilis cells .

Unlike typical SDP resistance mechanisms, YknWXYZ is constitutively expressed during growth, contrasting with the transient expression of SdpC at the onset of stationary phase . This suggests the transporter may serve additional functions beyond SDP resistance. Importantly, research has shown that while YknWXYZ expression protects B. subtilis from SDP, neither the amount nor the activity of SDP depends on the presence of YknWXYZ . This indicates that YknWXYZ likely functions by exporting SDP or by modifying the cell envelope to prevent SDP's toxic effects, rather than by regulating SDP production or processing.

The YknWXYZ complex differs from other membrane fusion protein (MFP)-dependent transporters in that its activity and assembly require YknW but proceed in the absence of SDP . This suggests that YknW may serve as a regulatory component that allows the transport system to respond to specific environmental or physiological cues beyond simply the presence of SDP toxin.

What strategies can be employed to determine the structure-function relationship of YknW?

Table 2: Experimental Approaches for YknW Structure-Function Analysis

ApproachMethodologyExpected Outcomes
Transmembrane Topology AnalysisCysteine scanning mutagenesis combined with accessibility labelingIdentification of membrane-spanning regions and orientation
Domain Deletion AnalysisCreate truncated YknW variants lacking specific domainsDetermine minimal functional units required for complex assembly and SDP resistance
Site-Directed MutagenesisTarget conserved residues in YknWIdentify amino acids critical for function and protein-protein interactions
Chimeric Protein ConstructionCreate YknW-Yip1 chimeras (bacterial-eukaryotic)Determine if functional domains are conserved between bacterial YknW and eukaryotic Yip1
Cross-Species ComplementationExpress YknW homologs from different Bacillus speciesAssess functional conservation across species
Structural PredictionComputational modeling based on related proteinsGenerate hypotheses about structure-function relationships

These approaches, when combined with functional assays for YknW activity (such as SDP resistance tests and complex assembly analyses), can provide comprehensive insights into how YknW's structure relates to its function in the YknWXYZ complex.

How can researchers investigate potential substrates for the YknWXYZ transport system beyond SDP?

While the YknWXYZ complex has been primarily characterized for its role in SDP resistance, its constitutive expression pattern suggests it may transport additional substrates or function in other cellular processes. Researchers should consider:

  • Metabolomics Approaches: Compare the exometabolomes of wild-type and YknWXYZ-deficient strains using liquid chromatography-mass spectrometry to identify differentially accumulated compounds that might represent substrates .

  • Transcriptomics Analysis: RNA-seq comparing wild-type and YknWXYZ mutant strains under various stress conditions could reveal pathways affected by YknWXYZ activity .

  • Cross-Resistance Testing: Test YknWXYZ-deficient strains for sensitivity to various antimicrobial compounds, including antibiotics, bacteriocins, and membrane-active peptides .

  • Transport Assays: Develop in vitro transport assays using reconstituted proteoliposomes containing the YknWXYZ complex to directly measure transport activities for candidate substrates .

  • Chemical Genetics: Screen chemical libraries for compounds that specifically affect YknWXYZ-deficient strains to identify potential transport substrates or related cellular processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.