Recombinant Bacillus subtilis Uncharacterized protein ynfC (ynfC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms
ynfC; BSU18110; Uncharacterized protein YnfC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ynfC
Target Protein Sequence
MDWGIIIKIFSNIKGGGDHLKKVTILKASILFLAIASFHLFSIPHAFDIGHHYKAVADQQ EMHEMKAGQNADDEKKSITGAFTLTALWAMAVLLLTAESKSTGYSRRRQRKKSFILAKFY QSSYFGKLHVQHHPIM
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis and why is it significant for protein research?

Bacillus subtilis is a rod-shaped, spore-forming, Gram-positive facultative aerobic bacterium that has gained significant attention in research and biotechnology. It is naturally found as part of the normal gut microbiota in humans and plays a critical role in immune development and supporting digestive health . As a model organism, B. subtilis has several advantages for protein research including: a well-characterized genome, established genetic manipulation tools, efficient protein secretion systems, and GRAS (Generally Recognized As Safe) status. These characteristics make it an excellent platform for studying uncharacterized proteins and for developing recombinant protein expression systems.

What does "uncharacterized protein" mean in the context of B. subtilis research?

An uncharacterized protein, such as ynfC in B. subtilis, refers to a protein whose gene has been identified in the genome but whose biological function, structure, and biochemical properties remain largely unknown or incompletely understood. These proteins are typically identified during genome sequencing and annotation processes but require further experimental characterization. In B. subtilis, approximately 30% of proteins remain functionally uncharacterized, representing significant research opportunities for discovering novel biological functions, pathways, and potential biotechnological applications.

What expression systems are commonly used for recombinant protein production in B. subtilis?

For expressing recombinant proteins in B. subtilis, several expression systems have been developed with different characteristics:

  • The pHT vector system (e.g., pHT43) utilizes IPTG-inducible promoters for controlled expression of target proteins, as demonstrated in studies expressing fusion proteins like RFP-COE .

  • pAX01-based systems allow for chromosomal integration of expression cassettes under the control of inducible promoters like PxylA (xylose-inducible), enabling stable expression without antibiotic selection pressure .

  • CRISPR-Cpf1 based systems can be used for both genome editing and integrating expression cassettes at specific chromosomal locations, such as the sacA or ganA sites .

The choice of expression system depends on research objectives, required expression levels, and whether secretion or intracellular expression is desired.

What is the recommended workflow for initial characterization of an uncharacterized protein like ynfC?

When characterizing an uncharacterized protein like ynfC in B. subtilis, a systematic approach is recommended:

  • Bioinformatic analysis: Begin with sequence analysis using tools like BLAST, Pfam, and AlphaFold to identify potential homologs, conserved domains, and predicted structure.

  • Expression and purification: Clone the gene into an appropriate expression vector (e.g., pHT43) and express the protein in B. subtilis WB800N or other suitable strains .

  • Protein verification: Confirm expression using Western blot analysis with appropriate antibodies, as demonstrated in recombinant B. subtilis studies .

  • Functional screening: Perform basic biochemical assays based on predicted functions from bioinformatic analysis.

  • Localization studies: Determine subcellular localization using fluorescent fusion proteins or fractionation techniques.

  • Interaction partners: Identify potential binding partners using pull-down assays or two-hybrid screening.

This workflow provides a foundation for further detailed characterization based on initial findings.

How can CRISPR-Cpf1 technology be utilized for studying ynfC function?

CRISPR-Cpf1 technology offers powerful tools for studying the function of uncharacterized proteins like ynfC in B. subtilis:

  • Gene knockout studies: The CRISPR-Cpf1 system can achieve 100% deletion efficiency of target genes, as demonstrated for the sacA gene, allowing researchers to observe phenotypic changes resulting from ynfC deletion .

  • Gene tagging: The system can be used to insert reporter genes (like sfGFP) into the chromosome in-frame with ynfC, enabling visualization of protein localization and expression patterns .

  • Inducible expression systems: Combining CRISPR-Cpf1 with inducible promoters allows controlled expression of ynfC for functional studies .

  • Portable editing tools: The development of portable CRISPR-Cpf1 systems enables efficient genome editing in B. subtilis without requiring integration of large constructs .

When designing crRNA for targeting ynfC, researchers should select PAM sequences (5′-TTTG-3′) within the gene and design appropriate homology arms for the desired genetic modification .

What proteomics approaches are most informative for studying uncharacterized proteins?

For comprehensive characterization of uncharacterized proteins like ynfC, multiple proteomics approaches should be employed:

  • Mass spectrometry-based identification: LC-MS/MS can confirm protein identity and sequence, detect post-translational modifications, and identify interaction partners in pull-down experiments.

  • Protein-protein interaction mapping: Techniques such as crosslinking-MS, proximity labeling (BioID), or co-immunoprecipitation followed by MS can reveal the protein interaction network of ynfC.

  • Structural proteomics: Methods like hydrogen-deuterium exchange MS (HDX-MS) can provide insights into protein dynamics and conformational changes.

  • Quantitative proteomics: SILAC, TMT, or label-free quantification can measure changes in ynfC abundance under different conditions.

  • Secretomics: Analysis of secreted proteins in B. subtilis culture supernatants can determine if ynfC is secreted and under what conditions.

These approaches, when combined, provide a multi-dimensional view of protein function that is especially valuable for uncharacterized proteins.

How can transcriptional analysis complement protein studies of ynfC?

Transcriptional analysis provides crucial context for understanding the function and regulation of uncharacterized proteins like ynfC:

  • RNA-Seq under various conditions: Measuring transcriptional changes of ynfC under different growth conditions, stress responses, or developmental stages can provide clues about its biological context.

  • Transcriptional start site mapping: Techniques like 5′ RACE or Cappable-seq can precisely identify the transcription start site and help characterize the promoter region.

  • Transcriptional regulation: ChIP-seq can identify transcription factors that bind to the ynfC promoter region.

  • Co-expression analysis: Identifying genes with similar expression patterns to ynfC can suggest functional relationships through guilt-by-association.

  • Ribosome profiling: This technique can reveal translational efficiency and potential regulatory mechanisms at the translation level.

Combining transcriptional data with protein-level studies provides a more complete understanding of gene function and regulation within the cellular context.

How can genetic approaches reveal the function of ynfC?

Genetic approaches provide powerful tools for understanding the function of uncharacterized proteins:

  • Gene deletion/knockout: Using CRISPR-Cpf1 systems to delete ynfC and observe resulting phenotypes. The high editing efficiency (100%) demonstrated with sacA gene deletion in B. subtilis makes this approach particularly promising .

  • Complementation studies: Reintroducing ynfC (wild-type or mutant variants) to knockout strains to confirm phenotypic restoration.

  • Overexpression phenotypes: Expressing ynfC under inducible promoters like Pgrac used in pHT01-based systems to observe gain-of-function phenotypes .

  • Conditional mutants: Creating temperature-sensitive or degron-tagged versions of ynfC to study essential functions.

  • Suppressor screens: Identifying mutations that suppress phenotypes associated with ynfC deletion or overexpression.

These approaches should be combined with careful phenotypic characterization, including growth rates, morphology, stress responses, and specialized phenotypes relevant to predicted functions.

What immunological approaches are relevant when studying B. subtilis proteins like ynfC?

For proteins with potential immunological relevance, several approaches can be employed:

  • Production of recombinant proteins for immunization: B. subtilis can be engineered to express recombinant proteins for immunization studies, as demonstrated with the RFP-COE and RFP-COE-L-Lectin-β-GF fusion proteins .

  • Analysis of immune responses: Following immunization with recombinant B. subtilis expressing ynfC, researchers can measure specific antibody responses (IgG, IgA) in serum and mucosal surfaces .

  • M cell targeting: If ynfC is to be used in mucosal immunity studies, its interaction with M cells can be studied using approaches similar to those employed for other B. subtilis recombinant proteins .

  • Cytokine profiling: Measuring cytokine responses to recombinant B. subtilis expressing ynfC can provide insights into the type of immune response elicited.

  • Ligated loop experiments: This approach can be used to study the interaction between recombinant B. subtilis expressing ynfC and intestinal tissues .

These approaches are particularly relevant if ynfC has potential applications in vaccine development or immunomodulation.

What are common challenges in expressing uncharacterized proteins in B. subtilis and how can they be addressed?

Researchers often encounter several challenges when expressing uncharacterized proteins in B. subtilis:

  • Low expression levels:

    • Problem: Insufficient protein production for detection or purification.

    • Solution: Optimize codon usage for B. subtilis, use stronger promoters like P43, or try different induction conditions with IPTG-inducible systems like those used in pHT43-based constructs .

  • Protein instability:

    • Problem: Rapid degradation of the expressed protein.

    • Solution: Use protease-deficient strains like WB800N (which lacks eight extracellular proteases), as used in successful expression of fusion proteins .

  • Inclusion body formation:

    • Problem: Protein aggregation due to misfolding.

    • Solution: Lower expression temperature, co-express chaperones, or fuse with solubility enhancers like thioredoxin.

  • Inefficient secretion:

    • Problem: Poorly secreted proteins despite signal peptide presence.

    • Solution: Test different signal peptides or optimize the SEC pathway components.

  • Low transformation efficiency:

    • Problem: Difficulty in obtaining transformants with expression constructs.

    • Solution: Optimize electroporation conditions, use competent cell preparation protocols specific for B. subtilis, or consider using CRISPR-Cpf1 systems that have shown high efficiency .

How can the purity and yield of recombinant proteins be optimized in B. subtilis?

Optimizing protein purity and yield requires attention to several factors:

  • Expression system selection:

    • For intracellular proteins: pHT-based vectors with IPTG-inducible promoters provide controlled expression .

    • For secreted proteins: Vectors containing strong signal peptides like amyQ or aprE.

    • For stable expression: Chromosomal integration using pAX01-derived systems or CRISPR-Cpf1 methods .

  • Strain engineering:

    • Use protease-deficient strains like WB800N to minimize degradation .

    • Consider auxotrophic strains for defined media cultivation.

  • Culture conditions:

    • Optimize media composition, temperature, and aeration.

    • For IPTG-inducible systems, determine optimal induction timing (typically at OD600 = 0.5) and IPTG concentration .

  • Purification strategy:

    • Include affinity tags (His6, FLAG, etc.) for easier purification.

    • Develop multi-step purification protocols combining affinity chromatography with size exclusion or ion exchange steps.

  • Scale-up considerations:

    • Transition from shake flask to bioreactor cultivation for larger yields.

    • Implement fed-batch or continuous cultivation strategies for sustained production.

Careful optimization of these parameters can significantly improve both yield and purity of recombinant proteins from B. subtilis.

What are potential applications of recombinant B. subtilis in gut microbiome and health research?

Recombinant B. subtilis strains have significant potential in gut microbiome and health research:

  • Probiotics with enhanced function: B. subtilis is naturally part of the human gut microbiota and has been shown to play a critical role in immune development and supporting digestive health . Recombinant strains expressing proteins like ynfC could enhance these beneficial effects.

  • Treatment of gastrointestinal disorders: Studies have demonstrated that B. subtilis can improve symptoms in conditions like irritable bowel syndrome (IBS), with significant reductions in symptom severity scores after treatment .

  • Modulation of gut microbiota: B. subtilis supplementation has been shown to increase the dominance of beneficial bacteria such as B. crossotus, R. callidus, and B. bifidum in the gut .

  • Mucosal vaccine delivery: Recombinant B. subtilis can effectively deliver antigens to the mucosa, inducing both systemic and mucosal immune responses. Studies have shown increased sIgA levels in intestinal tracts and elevated specific antibody titers after oral administration of recombinant B. subtilis .

  • M cell targeting: Recombinant B. subtilis can be engineered to target M cells in gut-associated lymphoid tissues, enhancing antigen delivery and immune responses .

These applications highlight the versatility of recombinant B. subtilis as both a research tool and a potential therapeutic agent.

What future research directions are most promising for uncharacterized B. subtilis proteins?

Several promising research directions exist for uncharacterized B. subtilis proteins like ynfC:

  • Systematic functional genomics: High-throughput phenotypic screening of knockout libraries combined with multi-omics approaches to assign functions to uncharacterized proteins.

  • Structural biology initiatives: Solving structures of uncharacterized proteins to gain insights into their potential functions and to guide rational engineering efforts.

  • Protein interaction networks: Comprehensive mapping of protein-protein interactions to place uncharacterized proteins in functional networks.

  • Synthetic biology applications: Using uncharacterized proteins as novel building blocks in synthetic circuits or metabolic pathways.

  • CRISPR-based functional screening: Leveraging advanced genome editing tools like CRISPR-Cpf1 systems to systematically investigate the roles of uncharacterized proteins through precise genetic modifications .

  • Microbiome engineering: Exploring the potential of engineered B. subtilis expressing specific proteins for modulating the gut microbiome composition and function in health and disease .

  • Development of novel biotherapeutics: Using the understanding of previously uncharacterized proteins to design new therapeutic approaches, particularly for gastrointestinal disorders that respond to probiotic interventions .

These research directions will likely lead to significant advances in our understanding of B. subtilis biology and expand its applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.