Recombinant Bacillus subtilis Uncharacterized protein ynzE (ynzE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (additional fees apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ynzE; BSU18270; Uncharacterized protein YnzE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ynzE
Target Protein Sequence
MLTDPAEEAFLPNFLLLGAGTALVLCLVFFLYQKLDQSQFAVIKLGIWGSAVGLLMDTIS LWNLPLIFPALSKGQVIAFTIWMVCAYCMYLLIPLILSHKK
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bacillus subtilis and why is it preferred for recombinant protein expression?

Bacillus subtilis is a Gram-positive soil bacterium that offers several advantages for recombinant protein production. It can achieve doubling times as short as 20 minutes under optimal growth conditions (30-35°C), with fermentation cycles typically completing in approximately 48 hours compared to the 180 hours required for Saccharomyces cerevisiae . Unlike Gram-negative bacteria such as E. coli, B. subtilis does not produce endotoxins, which simplifies downstream purification processes and reduces production costs .

B. subtilis has natural competence for DNA uptake and efficient homologous recombination, making it particularly suitable for genetic manipulation. The bacterium has evolved to secrete enzymes into the extracellular environment, providing a convenient mechanism for recombinant protein secretion that streamlines downstream processing . These characteristics, along with its GRAS (Generally Regarded as Safe) status granted by the FDA, make B. subtilis an attractive host for recombinant protein expression.

What defines a protein as "uncharacterized" and what are the implications for research?

A protein is classified as "uncharacterized" when, despite being identified in the genome sequence, its biological function, biochemical properties, and structural characteristics remain largely unknown. In the case of B. subtilis, YisK was previously an uncharacterized protein before researchers determined it possessed oxaloacetate decarboxylase activity .

Uncharacterized proteins represent significant knowledge gaps in our understanding of an organism's biology. These proteins are typically identified through genomic sequencing and annotation but lack experimental validation of their functions. Studying uncharacterized proteins like ynzE provides opportunities to discover novel enzymatic activities, biological pathways, or structural motifs that may have important applications in biotechnology or medicine.

What genomic context analysis should be performed for initial characterization of ynzE?

Initial genomic context analysis of ynzE should include:

  • Identification of neighboring genes and potential operonic organization

  • Comparative genomic analysis across different Bacillus species and strains

  • Prediction of regulatory elements including promoters and terminators

  • Analysis of transcriptomic data to determine expression patterns

  • Examination of gene conservation and synteny across related bacteria

What standard cloning and expression strategies are effective for B. subtilis proteins?

Based on established protocols for B. subtilis proteins, the following methodological approach is recommended:

  • Isolation of genomic DNA from B. subtilis cultures grown under standard conditions (pH 7.0, 30°C on nutrient agar medium containing sodium chloride, beef extract, and peptone)

  • Amplification of the ynzE gene using manually designed sequence-specific primers

  • Restriction digestion of PCR products and cloning into suitable vectors (e.g., initial cloning into pUC57 followed by subcloning into pET22b+ with C-terminal poly-histidine tags)

  • Verification of clone integrity by sequencing

  • Expression optimization using different induction conditions and host strains

For expression within B. subtilis itself, specialized tools such as genome-editing platforms using CRISPR and MAD7 enzymes are recommended . Additionally, integrative methods combining antibiotic resistance genes and conditional auxotrophy have proven effective for generating recombinant B. subtilis strains .

What methodologies are most effective for determining the subcellular localization of ynzE?

Determining the subcellular localization of ynzE requires a multi-faceted approach:

  • Fluorescent protein fusions (ynzE-GFP) for live-cell imaging

  • Immunofluorescence microscopy using antibodies against ynzE or epitope tags

  • Cell fractionation followed by Western blotting

  • Co-localization studies with known cellular markers

  • Creation of localization-deficient variants through site-directed mutagenesis

This approach is supported by successful localization studies of other B. subtilis proteins. For example, YisK was shown to localize as puncta in a manner dependent on the elongasome protein Mbl . Additionally, researchers demonstrated that a non-localizing variant (YisK E30A) retained enzymatic activity but showed diffuse localization and altered phenotypic effects, highlighting the importance of proper localization for protein function .

How can structural studies inform functional predictions for uncharacterized proteins like ynzE?

Structural studies provide crucial insights into protein function through:

  • X-ray crystallography or cryo-EM to determine three-dimensional structure

  • Identification of structural homology to characterized proteins

  • Recognition of conserved catalytic motifs and binding pockets

  • Structure-guided mutagenesis to confirm functional predictions

The value of this approach is exemplified by YisK, where crystal structures revealed close structural similarity to two oxaloacetate decarboxylases: human mitochondrial FAHD1 and Corynebacterium glutamicum Cg1458 . This structural information directly guided functional studies that confirmed YisK's ability to catalyze the decarboxylation of oxaloacetate (Km = 134 μM, Kcat = 31 min−1) .

Structure-guided mutagenesis can further validate functional predictions, as demonstrated with the YisK E148A, E150A catalytic dead variant that retained wild-type localization but lost enzymatic activity .

What genetic manipulation strategies would best facilitate functional studies of ynzE?

Several genetic manipulation strategies are recommended for studying ynzE function:

  • Construction of clean deletion mutants using marker-free methods

  • Development of conditional expression systems to control ynzE levels

  • Generation of site-directed mutants to disrupt predicted functional domains

  • Creation of reporter fusions to monitor expression patterns

  • Implementation of complementation systems to verify phenotypes

The integrative method described by Fabret et al. combines the use of blaI (a repressor involved in β-lactamase regulation), an antibiotic resistance gene, and a conditional lysine-auxotrophic B. subtilis strain . This approach allows for marker-free genetic modifications, enabling either gene deletion or controlled expression .

For overexpression studies, inducible promoter systems (e.g., IPTG-inducible) allow for tight regulation of expression levels . Phenotypic effects can be assessed using plate growth assays, where cells are back-diluted to various optical densities, spotted on appropriate media, and incubated under controlled conditions .

What biochemical approaches are most informative for characterizing potential enzymatic activities of ynzE?

A comprehensive biochemical characterization strategy includes:

ApproachMethodologyExpected Outcome
Substrate screeningIncubation with candidate substrates followed by HPLC/MS analysisIdentification of potential enzymatic activities
Kinetic analysisSpectrophotometric assays with varying substrate concentrationsDetermination of Km, Kcat, and catalytic efficiency
Cofactor requirementsActivity assays with and without potential cofactorsIdentification of essential cofactors
pH and temperature optimaActivity measurements under varying conditionsDetermination of optimal reaction conditions
Inhibitor studiesActivity assays in presence of specific inhibitorsInsights into catalytic mechanism

This approach proved successful for YisK, which was found to catalyze the decarboxylation of oxaloacetate to pyruvate and CO2 . The study determined specific kinetic parameters (Km = 134 μM, Kcat = 31 min−1) and generated catalytic dead variants through targeted mutagenesis of key residues (E148A, E150A) .

What protein-protein interaction methods would be most suitable for identifying ynzE binding partners?

Multiple complementary approaches should be employed:

  • Bacterial two-hybrid analysis as described for YisK, where interactions can be visualized through color development on appropriate indicator plates

  • Pull-down assays using His-tagged or other affinity-tagged versions of ynzE

  • Co-immunoprecipitation coupled with mass spectrometry

  • Crosslinking techniques to capture transient interactions

  • Genetic suppressor screens to identify functional interactions

Genetic interaction studies can provide valuable insights, as demonstrated with YisK, where overexpression led to cell widening and lysis phenotypes that were dependent on mbl and suppressed by mbl mutations . This suggests that similar approaches could reveal functional relationships between ynzE and other cellular components.

How can transcriptomic and proteomic approaches enhance understanding of ynzE function?

Multi-omics approaches provide contextual information about ynzE function:

  • RNA-Seq analysis under various growth conditions to identify co-regulated genes

  • Proteomics to detect changes in protein abundance in ynzE mutants

  • Metabolomics to identify altered metabolic pathways

  • ChIP-Seq to identify potential transcription factors regulating ynzE

  • Ribosome profiling to assess translational regulation

These approaches can place ynzE within broader cellular networks and pathways, similar to how YisK was identified as "the first example of an enzyme implicated in central carbon metabolism with subcellular localization that depends on Mbl" .

What optimization strategies can overcome expression challenges for difficult B. subtilis proteins?

Several optimization strategies have proven effective:

  • Selection from libraries of secretion signal peptides to enhance protein translocation and secretion

  • Implementation of codon optimization algorithms specifically tailored for B. subtilis expression

  • Screening of protease-deficient host strains, such as those in the Bacillus Ingenza Optimization (BINGO) platform

  • Fine-tuning expression using alternative promoters and ribosome binding sites

  • Optimization of growth and induction conditions

As noted in the literature, combining these approaches can significantly improve yields: "Combining the codABLE and BINGO technologies with signal-peptide library screening enables Ingenza to double product yields and stabilities for g/L production of novel enzymes and therapeutic targets" .

What computational approaches provide the most reliable functional predictions for uncharacterized proteins?

A robust computational analysis pipeline should include:

  • Sequence homology searches against characterized protein databases

  • Structural modeling and comparison with solved protein structures

  • Analysis of conserved domains and motifs that suggest enzymatic activities

  • Genomic context examination to identify operons and gene clusters

  • Integration of phylogenetic profiling to identify co-evolving genes

For YisK, structural comparison revealed its membership in the fumarylacetoacetate hydrolase (FAH) superfamily and structural similarity to known oxaloacetate decarboxylases, which directly guided functional characterization . Similar computational approaches would provide valuable initial hypotheses about ynzE function.

How can phenotypic screens most effectively reveal the physiological role of ynzE?

Comprehensive phenotypic screening should include:

  • Growth analysis under various stress conditions (oxidative, osmotic, temperature)

  • Microscopic examination of cellular morphology in wild-type and mutant strains

  • Assessment of biofilm formation and sporulation efficiency

  • Metabolic profiling under different carbon and nitrogen sources

  • Competitive fitness assays with wild-type strains

The importance of phenotypic analysis is illustrated by YisK, where overexpression led to specific cellular phenotypes (cell widening and lysis) that provided clues about its functional relationship with the cell envelope synthesis machinery .

What considerations are important when designing site-directed mutagenesis studies for ynzE?

Site-directed mutagenesis studies should be guided by:

  • Conservation analysis to identify evolutionarily conserved residues

  • Structural predictions to locate potential catalytic or binding sites

  • Design of both alanine-scanning and conservative mutations

  • Creation of specific mutations to disrupt predicted functional domains

  • Development of complementary in vivo and in vitro assays to assess mutant effects

This approach was successfully used for YisK, where specific mutations (E148A, E150A) created a catalytic dead variant that retained wild-type localization, while another mutation (E30A) affected localization but not enzymatic activity . Such selective mutations can help dissect the relationship between different protein functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.