Recombinant Bacillus subtilis Uncharacterized protein yobJ (yobJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yobJ; BSU18980; Uncharacterized protein YobJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-280
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yobJ
Target Protein Sequence
MELLDIWNWIQQNGILTAVITGIVALLFNQRQKSIERFYSQSGETLEKILEPMYYSLKEI KNEEDENHKMVLIEKFFEEYSGKKGKLSKLRNILLIDQILNTEDCFREYILNKNSENRKK LFYKMRMLDQAVNKEYRSIFVTLNKNYNWYKVLFRTNYILSAVFVFVRWFKETLAFFVGA SAFAFIPLLYDKYLGEQVLGNWLEVNKLIFGLSCSALYIFWIIHYFLLKDTMQRKDEISL FQEWFDKTKLGKWTNKNVWGKIGNWNVERRARRVRNDEDV
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is currently known about the uncharacterized protein YobJ in Bacillus subtilis?

YobJ is classified as a hypothetical protein from Bacillus subtilis subsp. subtilis str. 168 with UniProt ID O34774 and Gene ID 939633 . As an uncharacterized protein, its physiological function remains unknown, although its gene sequence has been identified through genomic sequencing. The protein can be recombinantly expressed with a histidine tag, typically with >80% purity as determined by SDS-PAGE . Like many uncharacterized bacterial proteins, YobJ might be part of important cellular processes that have not yet been experimentally validated. The ongoing characterization of such proteins is critical to filling knowledge gaps in the B. subtilis proteome, as emphasized by recent efforts to characterize previously unknown proteins across various organisms .

What expression systems are recommended for producing recombinant Bacillus subtilis YobJ?

Recombinant YobJ is typically produced using either E. coli or yeast expression systems . For research applications, E. coli-based expression is frequently preferred due to its rapid growth, high protein yields, and well-established protocols. The protocol typically involves:

  • Cloning the yobJ gene into an expression vector containing a histidine tag sequence

  • Transforming the construct into an appropriate E. coli strain (commonly BL21(DE3) or similar)

  • Inducing expression under optimized conditions

  • Purifying using immobilized metal affinity chromatography (IMAC)

Similar approaches have been successfully used for other B. subtilis proteins such as EXLX1 (encoded by yoaJ), where the gene was inserted into pET22b vector and expressed in E. coli strain BL21(DE3-pLys), with the native signal peptide replaced by the pelB signal peptide . For proteins requiring post-translational modifications, yeast expression systems may be preferable, though this is generally determined experimentally on a case-by-case basis.

What purification methods yield the highest purity for recombinant YobJ protein?

The standard purification protocol for His-tagged YobJ involves multiple chromatographic steps to achieve >80% purity :

  • Initial capture using nickel or cobalt IMAC

  • Buffer exchange to remove imidazole

  • Optional secondary purification using size exclusion chromatography (SEC) or ion exchange chromatography (IEX)

  • Quality control by SDS-PAGE and endotoxin testing (<1.0 EU per μg)

For functional studies requiring higher purity (>95%), additional purification steps may be necessary. The purification strategy should be optimized based on the specific downstream applications and required protein characteristics. Storage recommendations include short-term storage at +4°C and long-term storage at -20°C to -80°C in PBS buffer to maintain protein stability .

What are effective strategies for determining the function of uncharacterized proteins like YobJ?

Determining the function of uncharacterized proteins requires a multi-faceted approach:

  • Bioinformatic Analysis:

    • Sequence homology searches against characterized proteins

    • Structural prediction and modeling

    • Genomic context analysis (neighboring genes, operons)

    • Identification of conserved domains or motifs

  • Experimental Approaches:

    • Gene knockout/deletion studies to observe phenotypic changes

    • Transcriptional profiling under various conditions using microarrays or RNA-seq

    • Protein interaction studies (pull-down assays, yeast two-hybrid)

    • Localization studies using fluorescent protein fusions

  • Functional Screening:

    • Testing for enzymatic activities based on predicted domains

    • Stress response analysis (as demonstrated for σB-dependent genes in B. subtilis)

    • Phenotype microarrays to identify conditions affecting mutant growth

Similar approaches have successfully identified functions of previously uncharacterized B. subtilis proteins, as evidenced by the characterization of YodL and YisK, which were found to modulate MreB and Mbl activity, potentially during early sporulation stages .

How can one design deletion mutants to study YobJ function in Bacillus subtilis?

Creating and analyzing yobJ deletion mutants involves:

  • Mutant Construction:

    • Gene interruption using a resistance cassette (similar to the EXLX1/yoaJ mutant created with a Tn10-Spc cassette)

    • Insertional mutagenesis using integration plasmids like pMUTIN

    • Clean deletions using Cre-loxP or other recombination systems

  • Phenotypic Analysis:

    • Growth curves under various conditions (temperature, pH, osmotic stress)

    • Microscopic examination for morphological changes

    • Stress response assessment

    • Sporulation efficiency testing (particularly important as other uncharacterized B. subtilis proteins like YodL and YisK affect sporulation)

  • Complementation Studies:

    • Reintroduction of yobJ at a neutral locus or under inducible promoter

    • Expression of yobJ variants to identify critical residues/domains

The approach demonstrated for EXLX1, where deletion did not affect growth in liquid medium but reduced colonization ability on plant roots and affected osmotic shock response , provides a useful template for investigating YobJ function.

What techniques can reveal potential binding partners or substrates of YobJ?

Identifying interaction partners and potential substrates requires multiple complementary approaches:

  • In vitro Techniques:

    • Pull-down assays using purified His-tagged YobJ as bait

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) for quantifying interactions

    • Activity-based protein profiling to identify potential substrates

  • In vivo Approaches:

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation followed by mass spectrometry

    • Crosslinking and identification of complexes (CLIC)

    • Fluorescence resonance energy transfer (FRET) with fluorescently tagged proteins

  • Substrate Screening:

    • Testing binding to common bacterial substrates (peptidoglycan, nucleic acids, etc.)

    • Metabolite profiling of wildtype versus deletion mutants

    • Differential scanning fluorimetry with potential ligands

For example, EXLX1 (YoaJ) was found to bind to plant cell walls, cellulose, and peptidoglycan through binding assays , suggesting that testing binding to cell wall components could be a productive approach for other uncharacterized B. subtilis proteins like YobJ.

How might YobJ participate in stress response pathways in Bacillus subtilis?

Investigating YobJ's role in stress response requires systematic analysis:

  • Transcriptional Regulation Analysis:

    • Determine if yobJ expression changes under various stress conditions

    • Analyze the yobJ promoter region for binding sites of stress-related transcription factors (particularly σB-dependent promoters)

    • Use transcriptional reporters (lacZ fusions) to monitor expression

  • Stress Response Phenotyping:

    • Compare growth and survival of wildtype and ΔyobJ strains under:

      • Heat shock

      • Osmotic stress

      • Oxidative stress

      • Nutrient limitation

    • Analyze cellular morphology during stress conditions

  • Integration with Known Stress Pathways:

    • Epistasis analysis with known stress response regulators

    • Transcriptome comparison of ΔyobJ with other stress response mutants

    • Proteomic analysis during stress response

The methodology used to identify σB-dependent general stress genes in B. subtilis , including transcriptional profiling and promoter sequence analysis, provides a valuable framework for investigating YobJ's potential role in stress response.

What structural analysis techniques are most suitable for an uncharacterized protein like YobJ?

Structural characterization of YobJ should follow a tiered approach:

The approach used for EXLX1/YoaJ, where crystal structure determination revealed similarity to plant β-expansins and identified potential polysaccharide-binding surfaces , demonstrates how structural analysis can provide crucial insights into the function of previously uncharacterized proteins.

How can proteomics approaches be utilized to study YobJ expression and regulation?

Comprehensive proteomic investigation of YobJ should include:

  • Expression Profiling:

    • Targeted mass spectrometry (MS) to quantify YobJ under different growth conditions

    • Global proteomics to identify co-regulated proteins

    • Ribosome profiling to analyze translation efficiency

  • Post-translational Modifications:

    • Phosphoproteomics to identify potential regulatory phosphorylation sites

    • Other modification-specific enrichment strategies (acetylation, methylation, etc.)

    • Protease susceptibility assays to identify structural domains

  • Protein Turnover and Regulation:

    • Pulse-chase experiments with stable isotope labeling

    • Determination of protein half-life under different conditions

    • Analysis of protein degradation pathways affecting YobJ levels

The techniques used in global stress response analysis of B. subtilis , particularly transcriptional profiling with DNA macroarrays, could be adapted and combined with modern proteomics approaches to understand YobJ regulation within the broader context of B. subtilis physiology.

How conserved is YobJ among different Bacillus species and related bacteria?

Understanding YobJ conservation requires phylogenetic analysis:

  • Sequence Conservation Analysis:

    • BLAST searches against genomic databases

    • Multiple sequence alignment of homologs

    • Identification of conserved residues or motifs

    • Calculation of selection pressure (dN/dS ratios)

  • Genomic Context Comparison:

    • Analysis of gene neighborhood across species

    • Identification of conserved operons or gene clusters

    • Correlation with ecological niches or lifestyles

  • Functional Implications:

    • Comparison with characterized homologs in other species

    • Correlation of presence/absence with specific phenotypes

    • Analysis of horizontal gene transfer events

This approach might reveal evolutionary patterns similar to those observed for other B. subtilis proteins like EXLX1, which has homologs in diverse plant pathogens, suggesting a role in plant-bacterial interactions .

What comparative experimental approaches can elucidate YobJ function across different bacterial species?

Cross-species functional analysis should include:

  • Heterologous Expression Studies:

    • Expression of YobJ homologs from different species in B. subtilis

    • Complementation assays in yobJ deletion mutants

    • Analysis of species-specific functional differences

  • Host Interaction Studies:

    • If YobJ might be involved in host interactions (like EXLX1 in plant colonization)

    • Comparison of colonization ability between species

    • Analysis of host-specific adaptations

  • Evolutionary Function Prediction:

    • Correlation of sequence variations with ecological niches

    • Identification of residues under positive selection

    • Reconstruction of ancestral sequences to trace functional evolution

Such comparative approaches could reveal whether YobJ, like EXLX1, might play roles in specific ecological contexts such as plant-microbe interactions or stress adaptation in different environments.

How can CRISPR-Cas9 technology be optimized for studying YobJ function in Bacillus subtilis?

CRISPR-Cas9 provides powerful tools for YobJ functional analysis:

  • Genome Editing Applications:

    • Creation of clean deletions without antibiotic markers

    • Introduction of point mutations to study specific residues

    • Generation of truncations or domain deletions

    • Insertion of epitope tags or fluorescent proteins at the native locus

  • Transcriptional Modulation:

    • CRISPRi for inducible knockdown without genetic deletion

    • CRISPRa for upregulation of yobJ expression

    • Multiplexed targeting of yobJ and potential interaction partners

  • Implementation Considerations:

    • Selection of appropriate Cas9 variants for B. subtilis

    • Design of efficient sgRNAs with minimal off-target effects

    • Optimization of transformation and selection protocols

    • Verification of edits through sequencing and phenotypic analysis

These approaches build upon traditional genetic methods used for other B. subtilis genes like yoaJ and yodL/yisK , but offer greater precision and efficiency.

What high-throughput approaches can accelerate the functional characterization of YobJ?

Accelerated functional discovery requires systematic approaches:

  • Omics Integration:

    • Multi-omics profiling (transcriptomics, proteomics, metabolomics) of ΔyobJ mutants

    • Network analysis to position YobJ in cellular pathways

    • Machine learning to predict function from integrated datasets

  • High-throughput Phenotyping:

    • Automated growth analysis under hundreds of conditions

    • High-content imaging for morphological analysis

    • Flow cytometry with fluorescent reporters for cellular states

  • Systematic Interaction Mapping:

    • Proximity labeling approaches (BioID, APEX)

    • Protein microarray screening

    • Pooled CRISPR screens to identify genetic interactions

This multi-faceted approach resembles strategies used to characterize the general stress response in B. subtilis , but leverages newer technologies for greater throughput and precision.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.