Recombinant Bacillus subtilis Uncharacterized protein ypbD (ypbD)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

ypbD is typically expressed in heterologous hosts such as Escherichia coli due to the ease of genetic manipulation and scalability of bacterial systems . Recombinant ypbD is often tagged with affinity peptides (e.g., His-tag) to facilitate purification.

ParameterDetailsSource
Host OrganismE. coli
TagN-terminal His-tag
Expression RegionFull-length (1–189 amino acids)
PurificationImmobilized metal affinity chromatography (IMAC) for His-tagged proteins

Research Applications

While ypbD’s biological function remains undefined, its recombinant form serves as a tool for:

  • Structural Studies: X-ray crystallography or NMR to determine tertiary structure.

  • Interaction Assays: Identifying binding partners using co-IP or pull-down methods.

  • Immunological Reagents: ELISA kits (e.g., CSB-CF343877BRJ) for detecting ypbD in samples .

Challenges and Future Directions

  • Functional Elucidation: Bioinformatics tools (e.g., BLAST) and knockout studies in B. subtilis are needed to infer ypbD’s role.

  • Protease Sensitivity: B. subtilis has robust proteolytic systems, which may degrade recombinant ypbD during expression .

  • Large-Scale Production: Optimizing expression vectors (e.g., inducible promoters) to enhance yield .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ypbD; BSU23010; Uncharacterized protein YpbD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ypbD
Target Protein Sequence
MTQLLIIFAAAAAGLFFFEDVRDVLKLWDIRDMRIIWYGVSIAVIVILADMAVMKWFPSH LYDDGGINKKIFSKRSIPHIIFLTLLIAFAEEMLFRGVLQTHIGLWTASLIFAALHFRYL SKWLLFIMVTAISFLLGLMYEWTGNLFVPMTAHFIIDAVFACQIRFEHVRRDKHDEHVES REKKSPESL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the optimal B. subtilis strain for expressing recombinant ypbD protein?

When selecting a B. subtilis strain for ypbD expression, genome-minimized strains offer significant advantages over wild-type strains. Recent research indicates that strains lacking extracellular proteases, prophages, and spore development genes demonstrate superior recombinant protein production capabilities . For ypbD specifically, a genome-minimized strain could provide up to 3000-fold increased secretion compared to parental reference strains, as demonstrated with other target proteins .

The methodological approach should include:

  • Initial screening of multiple genome-minimized B. subtilis strains

  • Comparison against wild-type controls under standardized growth conditions

  • Quantitative assessment of ypbD expression yields through Western blotting or activity assays

  • Selection of the highest-performing strain for subsequent optimization experiments

For preliminary work, B. subtilis 168 derivatives with minimal genomes represent a solid starting point due to their well-characterized genetics and improved secretion capabilities.

What expression vectors are most suitable for ypbD production in B. subtilis?

The choice of expression vector significantly impacts ypbD production efficiency. For optimal results, consider the following methodological guidelines:

  • Select vectors containing strong, inducible promoters such as Pspac or PxylA to control expression timing

  • Incorporate efficient secretion signal sequences, with the native B. subtilis amyE or aprE signal sequences often performing well

  • Include codon-optimized ypbD sequences aligned with B. subtilis codon usage preferences

  • Consider vectors with compatible selection markers (chloramphenicol or kanamycin resistance)

For secreted production, vectors should include appropriate secretion signals to direct ypbD through the Sec or Tat secretion pathways, depending on protein characteristics. For cytoplasmic production, vectors with strong ribosome binding sites and optimal spacing between regulatory elements maximize translation efficiency .

How can I confirm successful expression of ypbD protein?

Verification of ypbD expression requires a multi-faceted analytical approach:

  • SDS-PAGE analysis of cell lysates (for cytoplasmic expression) or culture supernatants (for secreted expression)

  • Western blot verification using either anti-ypbD antibodies or detection via epitope tags (His, FLAG, etc.)

  • Mass spectrometry analysis for definitive protein identification

  • Activity assays, if applicable (requires knowledge or hypothesis of ypbD function)

For uncharacterized proteins like ypbD, incorporating a purification tag (His6) not only facilitates detection but also enables downstream purification through affinity chromatography. When analyzing expression patterns, compare samples collected at multiple time points post-induction to determine optimal harvest timing .

What are the optimal conditions for inducing disulfide bond formation in recombinant ypbD protein?

Disulfide bond formation is critical for proper folding of many proteins. For ypbD, which may contain multiple cysteine residues, establishing the correct methodology is essential:

  • Analyze the predicted ypbD sequence to identify potential disulfide bonds

  • Incorporate thiol-disulfide oxidoreductases (e.g., BdbA-D) as co-expression partners

  • Optimize redox conditions in the growth medium through controlled aeration

  • Consider secretion-based expression to leverage the naturally oxidizing environment of the extracellular space

Research demonstrates that genome-minimized B. subtilis strains with enhanced disulfide bond formation capabilities can achieve correct folding of complex proteins with multiple disulfide bonds . For ypbD, test multiple combinations of oxidoreductase co-expression and secretion signal sequences to identify optimal conditions for proper folding.

How can I design a factorial experiment to optimize ypbD production yields?

A systematic factorial design approach offers the most efficient path to optimizing ypbD production. Following established experimental design principles:

  • Identify key factors affecting expression: temperature (25-37°C), inducer concentration, medium composition, and harvest time

  • Design a full factorial or fractional factorial experiment examining these variables

  • Include appropriate controls and replicates for statistical validity

  • Analyze results using ANOVA to identify significant factors and interactions

For example, a 3×2 factorial design could examine three temperature levels (25°C, 30°C, 37°C) and two media formulations (defined minimal vs. complex) . This approach allows systematic identification of optimal conditions while revealing potential interactions between variables that might be missed in single-factor experiments. Data from such experiments should be analyzed using statistical methods to determine significance and optimize production parameters.

What strategies are effective for characterizing the function of uncharacterized proteins like ypbD?

Methodological approach for functional characterization of ypbD:

  • Bioinformatic analysis:

    • Sequence homology comparison with characterized proteins

    • Structural prediction using AlphaFold or similar tools

    • Identification of conserved domains or motifs

  • Experimental characterization:

    • Gene knockout or knockdown studies in B. subtilis to observe phenotypic changes

    • Protein-protein interaction studies (pull-downs, yeast two-hybrid)

    • Subcellular localization determination using fluorescently-tagged constructs

    • Biochemical assays based on predicted functions from bioinformatic analysis

  • Omics approaches:

    • Transcriptomic analysis comparing wild-type and ypbD mutant strains

    • Metabolomic profiling to identify altered metabolic pathways

    • Comparative proteomics to identify potential interaction partners

This multi-faceted approach combines computational predictions with experimental validation to systematically narrow down potential functions of ypbD .

How should I design control groups for ypbD expression experiments?

Proper control selection is critical for valid interpretation of ypbD expression results. A methodological approach includes:

  • Negative controls:

    • Empty vector transformants (same strain, same vector backbone without ypbD gene)

    • Untransformed host strain grown under identical conditions

    • Non-induced cultures of ypbD-containing strains

  • Positive controls:

    • Expression of a well-characterized B. subtilis protein under identical conditions

    • Commercial recombinant protein standards for quantification reference

    • Previously validated ypbD expression construct (if available)

  • Internal controls:

    • Housekeeping protein expression monitoring for normalization

    • Standardized reference samples across multiple experiments

This between-subjects design approach allows clear attribution of observed effects to ypbD expression rather than to experimental variables or strain characteristics . Include biological replicates (n=3 minimum) for each condition to enable statistical analysis.

What is the recommended approach for scaling up ypbD production from shake flasks to bioreactors?

Methodological approach for scale-up:

  • Initial optimization in shake flasks:

    • Establish baseline expression conditions (medium, temperature, induction parameters)

    • Determine key growth characteristics (doubling time, maximum OD, expression kinetics)

    • Identify potential limitations (oxygen transfer, nutrient depletion, proteolysis)

  • Bioreactor adaptation:

    • Transfer optimized conditions to controlled bioreactor environment

    • Implement fed-batch strategy to maintain nutrient availability

    • Monitor and control dissolved oxygen, pH, and temperature

    • Develop real-time monitoring of growth and expression

  • Process validation:

    • Perform replicate runs to confirm reproducibility

    • Analyze product quality attributes at different scales

    • Establish critical process parameters through Design of Experiments approach

Scale-up should proceed incrementally (shake flask → mini-bioreactor → production scale) with careful monitoring of protein quality and yield at each stage . Documentation of all parameters is essential for reproducibility and troubleshooting.

How can I quantitatively assess ypbD expression levels in different experimental conditions?

Quantitative assessment requires rigorous analytical methods:

  • Protein quantification techniques:

    • Densitometric analysis of Coomassie-stained SDS-PAGE gels

    • ELISA using specific antibodies or tag detection

    • Fluorescence-based quantification using labeled proteins

    • Absolute quantification via LC-MS/MS with isotope-labeled standards

  • Activity-based quantification (if function is known):

    • Enzyme kinetics measurements (Vmax, Km)

    • Binding assays for interaction partners

    • Functional complementation assays

  • Data analysis:

    • Normalization to appropriate controls

    • Statistical analysis (ANOVA, t-tests) to determine significance

    • Regression analysis for identifying optimal conditions

For meaningful comparisons between conditions, maintain consistent sampling methods, processing protocols, and analytical techniques throughout . Present data in standardized formats (nmol/mg total protein or units of activity/L culture) to facilitate comparison with literature values.

What statistical approaches are most appropriate for analyzing ypbD expression optimization experiments?

Statistical analysis methodology:

  • For factorial designs:

    • ANOVA to identify significant main effects and interactions

    • Post-hoc tests (Tukey's HSD) for pairwise comparisons

    • Response surface methodology for identifying optimal conditions

  • For time-course experiments:

    • Repeated measures ANOVA or mixed-effects models

    • Regression analysis for expression kinetics

    • Area under the curve calculations for cumulative production

  • For optimization studies:

    • Design of Experiments (DoE) approaches

    • Principal Component Analysis for multivariate optimization

    • Machine learning algorithms for complex datasets

Data should be pre-processed to check for normality and homogeneity of variance. For smaller datasets, non-parametric alternatives may be more appropriate. Always report effect sizes along with p-values to assess practical significance .

What purification strategy is recommended for recombinant ypbD protein?

A systematic purification approach includes:

  • Initial capture step:

    • Affinity chromatography using fusion tags (His6, GST, MBP)

    • Ion exchange chromatography based on predicted pI

    • Ammonium sulfate precipitation for initial concentration

  • Intermediate purification:

    • Size exclusion chromatography to remove aggregates

    • Hydrophobic interaction chromatography for additional selectivity

    • Second ion exchange step at different pH

  • Polishing steps:

    • Endotoxin removal (if intended for immunological studies)

    • Buffer exchange to stabilizing conditions

    • Concentration to required levels for downstream applications

For secreted ypbD, begin with culture supernatant concentration and diafiltration before chromatographic steps. For intracellular expression, optimize cell lysis conditions to maximize soluble protein recovery . Validate each purification step with SDS-PAGE and activity assays (if available) to ensure maintenance of protein integrity.

Purification StepTypical Recovery (%)Purity Increase (fold)Buffer Conditions
Culture filtration90-951-2Culture medium
Affinity chromatography70-8510-5050 mM Tris pH 8.0, 300 mM NaCl
Size exclusion80-902-520 mM Phosphate pH 7.4, 150 mM NaCl
Ion exchange75-852-1020 mM Tris pH 8.0, 0-500 mM NaCl gradient

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.