Recombinant Bacillus subtilis Uncharacterized protein ypbQ (ypbQ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ypbQ; BSU22040; Uncharacterized protein YpbQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ypbQ
Target Protein Sequence
MFWLLIAILIVQRAAEMAVARQNEQKVKKQGAIEFGESHYPYIITMHILFFLSLIAEVLL MNKQPSSWWLGIAAVILSVQIVRYWALCSLGAYWNTKILVVPGVELVKKGPYKWMKHPNY AVVILEILLIPLLYQAYVTMCLFSIFNAVLLSVRIRAEDKALQEYSVK
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ypbQ in Bacillus subtilis and why is it classified as "uncharacterized"?

The ypbQ protein in Bacillus subtilis is classified as uncharacterized because its physiological role, biochemical function, and structural properties remain largely undefined through experimental validation. While its gene sequence has been identified in the B. subtilis genome through sequencing efforts, the specific cellular function and biochemical activities of the protein product have not been fully elucidated. The classification "uncharacterized" indicates that current knowledge about the protein is primarily based on genomic data rather than functional studies, presenting an opportunity for researchers to explore its properties and potential significance in bacterial physiology.

What approaches are used to initially classify uncharacterized proteins like ypbQ?

Initial classification of uncharacterized proteins typically involves multiple complementary bioinformatic approaches. Sequence homology analysis using tools like BLAST searches against characterized protein databases can identify distant relatives with known functions. Domain prediction tools such as InterPro, Pfam, and SMART help identify conserved functional domains that might suggest potential biochemical activities. Structural prediction using tools like AlphaFold2 or I-TASSER can generate three-dimensional models based on amino acid sequence, potentially revealing structural similarities to known protein families. Gene neighborhood analysis examines the genomic context of ypbQ, as functionally related genes in bacteria are often organized in operons or functional clusters. Phylogenetic distribution analysis across bacterial species can provide insights into evolutionary conservation and potential importance. Combined, these approaches establish a preliminary functional hypothesis that guides subsequent experimental validation.

What is known about the genetic context of ypbQ in the B. subtilis genome?

The genetic context of ypbQ in the B. subtilis genome provides valuable insights into its potential function and regulation. Analyzing the genomic neighborhood often reveals operonic structures or functionally related gene clusters. For uncharacterized proteins like ypbQ, researchers would examine upstream and downstream genes, potential promoter regions, and regulatory elements. The genetic context analysis requires a methodical approach: first mapping the precise genomic coordinates of ypbQ, identifying adjacent genes within 5-10 kb in either direction, analyzing intergenic regions for potential promoters and terminators, and examining transcriptomic data for co-expression patterns. This contextual information helps formulate hypotheses about functional relationships and potential involvement in specific biochemical pathways or cellular processes, which then guides experimental design for functional characterization studies.

What expression systems are most effective for recombinant production of uncharacterized B. subtilis proteins?

For recombinant production of uncharacterized B. subtilis proteins like ypbQ, the choice of expression system is critical. B. subtilis itself represents an excellent homologous expression host due to its GRAS (generally recognized as safe) status and natural ability to incorporate exogenous DNA into its genome . Several expression systems have been optimized for B. subtilis, including those utilizing constitutive promoters (such as P43), inducible promoters (IPTG-inducible Pspac or xylose-inducible PxylA), and self-inducible expression systems .

What are the key methodological considerations when designing expression constructs for ypbQ?

When designing expression constructs for ypbQ, researchers should consider several methodological aspects to maximize protein yield and functionality. The selection of promoter systems significantly impacts expression levels - constitutive promoters offer consistent expression, while inducible systems provide temporal control . For B. subtilis expression systems, incorporating secretion signals like AmyE or AprE can facilitate protein export and simplification of purification processes.

Tag selection requires careful consideration: N-terminal versus C-terminal positioning may affect protein folding, and tag removal options (TEV or thrombin cleavage sites) should be incorporated if tags might interfere with structural studies. Codon optimization for the expression host is crucial, especially when expressing B. subtilis proteins in heterologous systems. The construct should include appropriate ribosome binding sites (RBS) with optimal spacing from the start codon to ensure efficient translation initiation.

Researchers should design multiple constructs with variations in these elements to identify optimal expression conditions. Validation of construct design through sequencing and restriction analysis before expression trials is essential to ensure construct integrity.

How can researchers optimize purification strategies for recombinant ypbQ?

Optimizing purification strategies for recombinant ypbQ requires a systematic approach to maintain protein integrity while achieving high purity. Initially, researchers should conduct small-scale expression tests with various affinity tags (His6, GST, MBP) to identify constructs yielding soluble protein. Establishing optimal lysis conditions is crucial - testing buffer compositions with varying pH (typically 7.0-8.0), salt concentrations (100-500 mM NaCl), and stabilizing additives like glycerol (5-10%) to maintain protein solubility.

For affinity chromatography, optimizing binding and elution conditions is essential. For His-tagged proteins, testing imidazole concentration gradients (typically 10-300 mM) can minimize non-specific binding while maximizing target protein recovery. Secondary purification steps should be selected based on protein properties - ion exchange chromatography for charged proteins or size exclusion chromatography for separating oligomeric states and removing aggregates.

Throughout purification, researchers should implement quality control checkpoints using SDS-PAGE, Western blotting, and activity assays (if available) to monitor protein integrity and purity. Final buffer optimization through thermal shift assays or differential scanning fluorimetry helps identify stabilizing conditions for long-term storage and subsequent experimental applications.

What approaches are most effective for predicting the function of uncharacterized proteins like ypbQ?

The methodological approach begins with generating high-quality structural models using tools like AlphaFold2 or experimental structure determination through X-ray crystallography or cryo-EM. Researchers then identify potential binding pockets and compare them against databases of characterized protein binding sites using tools like ProBiS . Molecular dynamics simulations can validate these predictions by assessing the stability of protein-ligand interactions and calculating binding free energies .

Complementary approaches include analyzing gene expression patterns to identify co-expressed genes, genetic context analysis, and phenotypic screening of knockout mutants. The integration of these multiple lines of evidence increases confidence in functional predictions and guides targeted experimental validation studies.

How should researchers approach experimental validation of predicted functions for ypbQ?

Experimental validation of predicted functions for ypbQ requires a systematic, multi-faceted approach. The methodology begins with generating knockout mutants using CRISPR-Cas9 or traditional homologous recombination techniques, followed by comprehensive phenotypic characterization under various growth conditions to identify conditions where ypbQ is essential or beneficial. Growth rate analysis, stress response tests, and metabolite profiling can reveal subtle phenotypic changes.

Complementation studies are crucial to confirm that observed phenotypes result directly from ypbQ deletion rather than polar effects or secondary mutations. These involve reintroducing the wild-type gene and testing if the phenotype is restored, while also testing point mutants targeting predicted functional residues to link specific biochemical activities to phenotypic outcomes.

Biochemical validation includes in vitro activity assays testing predicted enzymatic functions using purified recombinant protein. For proteins with predicted binding functions, techniques such as isothermal titration calorimetry, surface plasmon resonance, or fluorescence polarization can quantify interactions with potential binding partners. Structural validation through crystallization with potential ligands provides definitive evidence of binding site interactions and catalytic mechanisms.

What techniques are most valuable for analyzing protein-protein interactions involving ypbQ?

Analyzing protein-protein interactions (PPIs) involving uncharacterized proteins like ypbQ requires a strategic combination of complementary techniques to overcome technical challenges and validate findings. In vivo approaches begin with proximity-based methods like bacterial two-hybrid (B2H) systems or BACTH (Bacterial Adenylate Cyclase Two-Hybrid), which are particularly suitable for bacterial proteins. For more comprehensive interaction mapping, pull-down assays coupled with mass spectrometry provide an unbiased screen of potential interaction partners under physiologically relevant conditions.

In vitro methods offer higher resolution characterization of direct interactions. Biolayer interferometry (BLI) and isothermal titration calorimetry (ITC) provide quantitative binding parameters (Ka, Kd, ΔH, ΔS), while hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map interaction interfaces at the residue level. For structural characterization of complexes, cryo-electron microscopy is increasingly valuable for visualizing large protein assemblies that may be challenging to crystallize.

Computational methods should be integrated throughout, using tools like STRING or InterPreTS to predict potential interaction partners based on homology, co-expression, or genomic proximity. This multi-technique approach is essential because each method has inherent limitations and biases, particularly for membrane-associated or transiently interacting proteins.

How can researchers effectively apply structure-based function prediction to uncharacterized proteins?

Structure-based function prediction represents a powerful approach for uncharacterized proteins like ypbQ when sequence homology fails to identify functional relationships. The methodology demonstrated with the Tm1631 protein from Thermotoga maritima serves as an excellent template . The process begins with obtaining a high-quality structural model, either experimentally through X-ray crystallography/NMR or computationally using tools like AlphaFold2, with critical assessment of model quality and reliability.

The critical step involves identifying and characterizing potential binding sites using algorithms that analyze surface pockets, electrostatic properties, and conservation patterns. These predicted binding sites are then compared against libraries of characterized binding sites using tools like ProBiS . When similarities are identified with known functional sites, researchers construct protein-ligand models and validate them through molecular dynamics simulations, analyzing the stability of interactions and calculating binding free energies .

The methodology should include control analyses with structurally similar but functionally distinct proteins to establish specificity. This approach proved successful for Tm1631, revealing similarities with DNA-binding sites of endonuclease IV and leading to validation of DNA-binding activity . For uncharacterized proteins like ypbQ, this methodoloby represents a systematic pathway from structure to functional hypothesis to experimental validation.

What are the recommended protocols for site-directed mutagenesis studies of ypbQ to confirm functional predictions?

Site-directed mutagenesis studies for validating functional predictions of ypbQ require a systematic approach targeting specific amino acid residues predicted to be functionally important. The methodology begins with computational identification of critical residues based on structural models, conservation analysis, and binding site predictions. Researchers should prioritize residues located in predicted active sites, at protein-protein interaction interfaces, or with high evolutionary conservation.

For mutagenesis, the QuikChange method or Gibson Assembly techniques offer precise introduction of point mutations. The experimental design should include multiple types of mutations: alanine substitutions to remove side chain interactions while maintaining structural integrity; conservative substitutions that preserve physicochemical properties to test specific chemical requirements; and non-conservative substitutions that dramatically alter properties to test functional hypotheses. Control mutations in non-functional regions should be included to distinguish between specific functional effects and general structural disruption.

Each mutant should undergo thorough characterization following a standardized protocol: expression analysis to confirm protein stability, structural validation using circular dichroism or thermal shift assays to ensure proper folding, and functional assays tailored to the predicted activity. Quantitative comparison of wild-type and mutant proteins using enzyme kinetics (kcat, KM) or binding parameters (Kd) provides definitive evidence for the role of specific residues in function, establishing structure-function relationships for the previously uncharacterized ypbQ protein.

How should researchers approach conflicting data regarding ypbQ function or structure?

When confronted with conflicting data regarding ypbQ function or structure, researchers should implement a systematic resolution strategy rather than discarding contradictory results. The methodological approach begins with rigorous evaluation of experimental conditions across studies, creating a comprehensive table documenting differences in protein constructs (tags, truncations), expression systems, buffer compositions, and analytical techniques that might explain discrepancies.

Researchers should then design critical experiments specifically targeting the areas of contradiction, using multiple orthogonal techniques to address the same question. For example, if structural predictions conflict, combining X-ray crystallography, cryo-EM, and solution-based techniques like SAXS provides complementary structural information at different resolutions. For functional contradictions, using multiple activity assays with varying detection principles can identify potential artifacts in individual methods.

How does ypbQ research contribute to our understanding of bacterial protein function prediction methodologies?

Research on uncharacterized proteins like ypbQ serves as valuable case studies that advance protein function prediction methodologies applicable across bacterial species. Studies of such proteins help refine and validate structure-based prediction approaches, which are particularly important when sequence homology fails to provide functional insights . The methodological advances from ypbQ characterization contribute to improving computational algorithms for binding site prediction, enhancing sensitivity for detecting distant functional relationships between proteins with limited sequence similarity.

Such research also establishes validatio
n protocols for testing function predictions, creating a feedback loop that improves future prediction accuracy. When prediction methods successfully identify functions for proteins like ypbQ, they provide benchmarks for assessing the reliability of different computational approaches. Conversely, when predictions fail, analysis of these cases helps identify limitations in current methods and directs development of improved algorithms.

Furthermore, ypbQ research contributes to building comprehensive functional networks in B. subtilis, filling knowledge gaps in our understanding of this model organism's biology. As more uncharacterized proteins are functionally annotated, researchers gain insights into previously unknown biochemical pathways, regulatory mechanisms, and bacterial adaptations, enhancing our fundamental understanding of bacterial physiology and potentially revealing new targets for biotechnological applications.

What are the most promising techniques for high-throughput functional screening of ypbQ and similar uncharacterized proteins?

High-throughput functional screening of uncharacterized proteins like ypbQ requires methodological approaches that efficiently test multiple functional hypotheses simultaneously. Activity-based protein profiling (ABPP) represents one of the most promising techniques, using chemical probes that covalently bind to active sites of specific enzyme classes, allowing identification of enzymatic activities in complex mixtures. For implementing ABPP with ypbQ, researchers should design probe libraries targeting diverse enzyme families and optimize reaction conditions and detection methods for bacterial proteins.

Phenotypic microarrays provide another powerful approach, testing growth of ypbQ knockout strains across hundreds of different nutrient sources and stress conditions simultaneously. This methodology requires careful strain construction, including complementation controls, and sophisticated data analysis to identify subtle phenotypic differences that might indicate protein function.

For proteins with unknown binding partners, protein microarray technologies enable testing interactions with thousands of potential ligands in parallel. Arrays can be constructed with diverse molecules including metabolites, nucleic acids, and other proteins relevant to B. subtilis biology. Combined with machine learning approaches for data analysis, these high-throughput methods can rapidly generate and narrow functional hypotheses, directing subsequent in-depth validation studies to the most promising candidates.

What experimental approach would best determine if ypbQ forms part of a larger protein complex?

Determining whether ypbQ participates in protein complexes requires a multi-tiered experimental approach combining in vivo and in vitro methods. The methodological strategy begins with Blue Native PAGE (BN-PAGE) analysis of cellular extracts from B. subtilis strains expressing tagged ypbQ, allowing separation of intact protein complexes while preserving native protein-protein interactions. This should be complemented with size exclusion chromatography coupled to multi-angle light scattering (SEC-MALS) to determine absolute molecular weights of purified complexes and evaluate complex stoichiometry.

For identifying complex components, affinity purification coupled with mass spectrometry (AP-MS) provides comprehensive characterization. This methodology requires careful optimization of purification conditions to maintain complex integrity while minimizing non-specific interactions. Quantitative comparison between specific pulldowns and controls (using techniques like SILAC or TMT labeling) helps distinguish true interactions from background. Cross-validation using reverse pulldowns with antibodies against identified partners strengthens confidence in complex composition.

Structural characterization of identified complexes through cryo-electron microscopy or X-ray crystallography provides definitive evidence of complex formation and reveals the molecular basis of interactions. For dynamic or transient complexes, hydrogen-deuterium exchange mass spectrometry (HDX-MS) or FRET-based assays can capture interaction dynamics under various physiological conditions, providing insights into complex formation and regulation in vivo.

How should researchers approach comparative analysis between ypbQ and other characterized proteins?

Comparative analysis between ypbQ and characterized proteins requires a systematic, multi-dimensional approach that extends beyond simple sequence similarity. The methodology begins with hierarchical comparison starting with broad sequence analysis using sensitive tools like PSI-BLAST and HHpred that can detect distant relationships, followed by focused analysis of specific domains or motifs using tools like MEME and MAST to identify conserved functional elements that might not be apparent in global alignments.

Structural comparison represents a critical dimension, even when sequence similarity is low. Using tools like DALI or FATCAT to compare predicted or experimental structures of ypbQ against structural databases can reveal functional relationships through conservation of folding patterns and binding sites. This approach proved valuable for the Tm1631 protein, where binding site comparison revealed functional similarities despite limited sequence homology .

Functional comparison should integrate multiple data types, including gene co-expression patterns, genetic context, phenotypic profiles of knockout mutants, and biochemical properties. Researchers should develop a scoring system that weights different types of evidence based on reliability and relevance, creating a quantitative framework for evaluating functional similarity. Visualization tools like similarity networks help conceptualize relationships between proteins with complex, multi-faceted similarity metrics, aiding in the identification of functional clusters and evolutionary patterns.

What statistical approaches are recommended for analyzing and validating experimental data on ypbQ function?

Statistical analysis of experimental data on ypbQ function requires rigorous approaches tailored to the specific experimental methods employed. For biochemical assays measuring enzymatic activity or binding parameters, researchers should implement appropriate regression models (linear, Michaelis-Menten, Hill equation) with careful consideration of assumptions and constraints. Replicate measurements (minimum n=3, preferably n≥5) enable calculation of confidence intervals and standard errors for key parameters like Km, Vmax, or binding constants.

For comparative experiments between wild-type and mutant proteins or between different conditions, appropriate statistical tests should be selected based on data distribution and experimental design. Parametric tests (t-test, ANOVA) should only be used after confirming normality and homoscedasticity; otherwise, non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) are more appropriate. Multiple testing correction (Bonferroni, Benjamini-Hochberg) is essential when performing numerous comparisons to control false discovery rates.

For complex datasets like protein interaction networks or phenotypic screens, multivariate statistical approaches such as principal component analysis (PCA) or hierarchical clustering help identify patterns and relationships within the data. Proper validation requires both technical replication (repeated measurements) and biological replication (independent experiments) to account for different sources of variability. Power analysis should be conducted prior to experimentation to ensure sufficient sample sizes for detecting biologically relevant effects with statistical significance.

How can researchers effectively integrate structural, genetic, and biochemical data to develop a comprehensive model of ypbQ function?

Developing a comprehensive model of ypbQ function requires methodical integration of diverse data types, each providing complementary insights. The integration approach should begin with establishing a data management framework that standardizes and normalizes different data types to enable cross-comparison. Researchers should create a centralized database capturing structural predictions, genetic context, expression patterns, protein interaction data, and biochemical activities with appropriate metadata documenting experimental conditions and reliability metrics.

Bayesian network analysis provides a powerful framework for probabilistic integration of heterogeneous data, assigning confidence weights to different evidence types based on their reliability and consistency. This methodology allows researchers to quantify uncertainty in functional predictions while identifying the most probable functional models based on the collective evidence. For visualization and conceptualization, researchers should develop multi-layer network representations where different data types form distinct but interconnected layers, allowing visualization of how structural features relate to interaction partners and biochemical activities.

The integration process should follow an iterative model-building approach where initial hypotheses generate predictions that are experimentally tested, with results feeding back to refine the model. When inconsistencies arise between different data types, researchers should design critical experiments specifically targeting these contradictions rather than selectively emphasizing data that fits preconceived notions. This integrated approach enables development of a nuanced understanding of ypbQ function that accounts for structural constraints, genetic context, and biochemical activities within the broader physiological context of B. subtilis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.