Recombinant Bacillus subtilis Uncharacterized protein ypdP (ypdP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please specify your desired format when placing your order, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are standardly shipped with normal blue ice packs. Should you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ypdP; BSU21980; Probable queuosine precursor transporter; Q precursor transporter
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ypdP
Target Protein Sequence
MFNNSFWIFFAIIHFIIVLLFYKGFGKMGLFVWIGFATVCANLQVVKTVELFGLTATLGN VMYGTIFFATDVLNEKYGPAEARKAVWLGFSTLLTLTFVMQGVLLFEPASSDISQTALET IFGFLPRVALGSLLAFIFSQTLDVYVYSAIRRIFPSDRLLWLRNGGSTAVSQLFDTFIFT AVAFLGIYPADVWLHIFISTYLIKFAVSLISLPYAYAAKKMIPNDERSS
Uniprot No.

Target Background

Function
Plays a role in the import of queuosine (Q) precursors, essential for Q precursor salvage.
Database Links
Protein Families
Vitamin uptake transporter (VUT/ECF) (TC 2.A.88) family, Q precursor transporter subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most suitable for recombinant YpdP production?

Recombinant YpdP can be expressed in multiple host systems, each with distinct advantages:

Host SystemAdvantagesLimitations
E. coliBest yields, shorter turnaround times, well-established protocolsLimited post-translational modifications, potential inclusion body formation
YeastGood yields, some post-translational modifications, shorter turnaround time than mammalian cellsMore complex media requirements than E. coli
Insect cellsMany post-translational modifications, better protein foldingLonger production time, more expensive
Mammalian cellsComplete post-translational modifications, highest likelihood of correct foldingLongest production time, most expensive option

For initial characterization studies, E. coli systems typically offer the best balance of yield and time efficiency for YpdP expression .

What is currently known about the function of YpdP in Bacillus subtilis?

YpdP remains largely uncharacterized functionally. Based on its membrane topology with six predicted transmembrane segments, it likely functions as a transporter . It has been classified in the YhhQ transporter (Duf165) family in the Transporter Classification Database. While specific substrates and transport mechanisms remain unknown, proteins with similar membrane topology often serve as small molecule transporters or sensors in bacterial cell membranes.

What experimental design approaches are most effective for optimizing recombinant YpdP expression?

Factorial experimental design offers a systematic approach to optimize recombinant expression of membrane proteins like YpdP. Based on success with other B. subtilis proteins, consider the following parameters in a multifactorial design:

ParameterRecommended RangeConsiderations
Temperature20-30°CLower temperatures (25°C) often improve membrane protein folding
Induction time2-8 hours4 hours often optimal for balance of yield vs. aggregation
Inducer concentration0.05-1.0 mM IPTGLower concentrations (0.1 mM) often better for membrane proteins
Media compositionVarious5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, with 1 g/L glucose
Cell density at inductionOD₆₀₀ 0.4-1.0OD₆₀₀ 0.8 often provides optimal balance
Antibiotic concentration30-50 μg/mL30 μg/mL kanamycin typically sufficient

This approach can yield 200-250 mg/L of functional protein when properly optimized, as demonstrated with other challenging B. subtilis membrane proteins .

How can genome editing technologies be utilized to investigate YpdP function in B. subtilis?

CRISPR-Cas9 systems have proven effective for genome editing in B. subtilis and can be applied to functional characterization of YpdP:

  • Gene knockout studies: Create a ΔypdP strain to assess phenotypic changes, particularly under different stress conditions, to identify potential functions.

  • Targeted mutagenesis: Modify conserved residues to assess their importance for function. Focus on residues in transmembrane regions that may be involved in substrate recognition or transport.

  • Promoter engineering: Replace native promoters with inducible ones like Phyperspank to control expression levels for complementation studies .

  • Fluorescent tagging: Create C-terminal GFP fusions to study protein localization within the membrane while minimizing functional disruption.

Recent advances in B. subtilis genetic manipulation using the CRISPR-Cas9 system have improved efficiency to >90% for such modifications without leaving marker sequences .

What approaches can resolve the contradiction between in vitro and in vivo activities observed in some uncharacterized B. subtilis proteins?

Several B. subtilis proteins show discrepancies between in vitro and in vivo activities, as observed with YngB (another uncharacterized protein studied more extensively than YpdP). To resolve such contradictions with YpdP:

  • Analyze expression patterns under different growth conditions: YpdP may only be expressed under specific conditions (e.g., anaerobic conditions, as seen with YngB) .

  • Test activity under different physiological conditions:

    • Vary oxygen levels, pH, temperature, salt concentration

    • Test multiple potential substrates in parallel

    • Use cofactor supplementation (iron, sulfide, etc.)

  • Examine protein-protein interactions:

    • Perform pull-down assays to identify interaction partners

    • Use bacterial two-hybrid systems to confirm interactions

    • Consider that YpdP may require protein partners for full activity

  • Compare strain backgrounds:

    • Test functionality in different B. subtilis strains

    • Consider genetic background effects on protein function

What purification strategy is most effective for obtaining high-quality recombinant YpdP?

Membrane proteins like YpdP require specialized purification approaches:

StepRecommended MethodRationale
Cell lysisMechanical disruption (French press or sonication)Effective for breaking bacterial cell walls while maintaining membrane fragments
Membrane isolationUltracentrifugation (100,000 × g)Separates membrane fractions from cytosolic proteins
SolubilizationDetergent screening (DDM, LMNG, LDAO)Mild detergents preserve protein structure while extracting from membranes
Initial purificationIMAC (with His-tag)Effective for initial purification with minimal buffer exposure
Secondary purificationSize exclusion chromatographyRemoves aggregates and provides information on oligomeric state
Quality controlCircular dichroism, thermal shift assayConfirms proper folding of the membrane protein

For YpdP specifically, starting with a construct containing a cleavable N-terminal His10-tag has proven effective for other multi-pass membrane proteins from B. subtilis .

What are the most reliable approaches for functional characterization of YpdP?

Given YpdP's membrane localization and potential transport function, consider these methodological approaches:

How can researchers overcome common challenges in expressing multi-pass membrane proteins like YpdP in B. subtilis?

Common challenges with membrane protein expression in B. subtilis and their solutions include:

  • Protein misfolding and degradation:

    • Use protease-deficient B. subtilis strains (BINGO platform)

    • Lower induction temperature to 25°C

    • Co-express molecular chaperones (e.g., PrsA)

  • Low secretion efficiency:

    • Screen a library of secretion signal peptides (94+ options)

    • Optimize the signal peptide-protein junction

    • Consider using strong signal peptides like AmyE or SacB

  • Protein toxicity during expression:

    • Use strictly controlled inducible promoters (Phyperspank or Pxyl)

    • Titrate inducer concentration carefully

    • Employ auto-induction media for gradual expression

  • Low yields:

    • Apply codon optimization algorithms (e.g., codABLE)

    • Optimize Shine-Dalgarno sequence and spacing

    • Employ genome integration rather than plasmid-based expression for stability

Implementing these approaches has shown up to 2-fold improvement in yield and stability for challenging multi-pass membrane proteins in recent studies .

How can structural analysis of YpdP contribute to understanding bacterial membrane transport systems?

Structural analysis of YpdP could provide insights into:

  • Novel transporter architectures:

    • YpdP's 6-TMS arrangement may represent a structurally distinct transport system

    • Understanding core folding principles of multi-pass membrane proteins in bacteria

  • Substrate recognition mechanisms:

    • Identifying binding pockets through computational docking and site-directed mutagenesis

    • Determining selectivity filters for substrate specificity

  • Conformational changes during transport:

    • Capturing different conformational states through techniques like cryo-EM

    • Understanding the coupling mechanism between energy input and substrate movement

  • Evolution of transport systems:

    • Providing structural templates for homology modeling of related transporters

    • Tracing evolutionary relationships between different transporter families

Recent advances in membrane protein structural biology, particularly in cryo-EM techniques, make even challenging membrane proteins like YpdP increasingly amenable to structural characterization .

What phenotypic assays are most informative for elucidating YpdP function in B. subtilis?

To identify potential functions of YpdP, these phenotypic assays are particularly informative:

Phenotypic AssayMethodologyExpected Outcome if YpdP is Involved
Growth curve analysisCompare wild-type and ΔypdP strains under various conditionsGrowth defects under specific conditions (nutrient limitation, stress)
Membrane permeability assaysFluorescent dye uptake (propidium iodide)Altered membrane permeability in mutants
Metabolite profilingLC-MS/MS analysis of cellular metabolitesAccumulation/depletion of specific metabolites in mutants
Stress response evaluationExposure to osmotic, oxidative, pH stressesDifferential sensitivity to specific stressors
Nutrient utilizationGrowth on defined media with different nutrient sourcesInability to utilize specific nutrients in mutants
Competitive fitnessCo-culture with wild-type under various conditionsReduced fitness under conditions requiring YpdP function

Focus on conditions that affect membrane functions, as the transmembrane nature of YpdP suggests a role in membrane-associated processes .

How can proteomics approaches help characterize the function and interactions of YpdP?

Proteomics offers powerful approaches for understanding YpdP's biological context:

  • Comparative proteomics:

    • Compare wild-type and ΔypdP mutant proteomes to identify dysregulated pathways

    • Use both gel-based (2D-PAGE) and gel-free (LC-MS/MS) approaches

    • Apply quantitative techniques like SILAC or TMT labeling for precise measurements

  • Interactome analysis:

    • Use proximity labeling techniques (BioID, APEX) adapted for bacteria

    • Perform co-immunoprecipitation with tagged YpdP as bait

    • Apply cross-linking mass spectrometry (XL-MS) to capture transient interactions

  • Post-translational modification mapping:

    • Identify phosphorylation, glycosylation, or other modifications on YpdP

    • Determine if these modifications are regulated under specific conditions

    • Assess the impact of modifications on protein function

  • Localization studies:

    • Use protein correlation profiling across membrane fractions

    • Combine with super-resolution microscopy for spatial distribution

    • Examine co-localization with known membrane protein complexes

These approaches have successfully revealed functions of previously uncharacterized B. subtilis proteins in recent studies and can be applied to elucidate YpdP's functional role.

How might systems biology approaches enhance our understanding of YpdP's role in B. subtilis?

Systems biology offers integrative approaches to place YpdP in its broader cellular context:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data from wild-type and ΔypdP strains

    • Apply machine learning algorithms to identify patterns and correlations

    • Generate testable hypotheses about YpdP function from integrated datasets

  • Network analysis:

    • Place YpdP in the context of protein-protein interaction networks

    • Analyze transcriptional regulatory networks affecting ypdP expression

    • Identify functional modules that include YpdP

  • Flux balance analysis:

    • Develop computational models incorporating YpdP as a transport component

    • Predict metabolic consequences of YpdP dysfunction

    • Validate model predictions experimentally

  • Comparative genomics at scale:

    • Analyze patterns of gene co-occurrence across thousands of bacterial genomes

    • Identify conservation patterns and genomic context across species

    • Trace evolutionary history to identify functional constraints

These approaches have successfully identified functions of previously uncharacterized proteins in B. subtilis by placing them in their broader biological context .

What are the most promising strategies for determining whether YpdP has industrial or pharmaceutical applications?

While avoiding commercial production questions, these research strategies can assess potential applications:

  • Transport capability screening:

    • Test YpdP's ability to transport clinically relevant molecules

    • Evaluate transport of antimicrobial compounds in recombinant systems

    • Assess potential as a drug delivery component in engineered systems

  • Structural comparison to known drug targets:

    • Compare YpdP's predicted structure to established membrane protein drug targets

    • Identify binding pockets that could be targeted by small molecules

    • Assess conservation across pathogenic bacteria to evaluate target potential

  • Phenotypic impact of modulation:

    • Determine if YpdP overexpression or mutation affects bacterial persistence

    • Evaluate impact on biofilm formation or antibiotic resistance

    • Assess effects on bacterial survival under stress conditions

  • Biotransformation potential:

    • Test if YpdP can transport or modify compounds of interest

    • Evaluate potential in bioremediation applications

    • Assess compatibility with existing bioprocessing systems

These research directions maintain academic focus while exploring potential applied significance of YpdP .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.