Recombinant Bacillus subtilis Uncharacterized protein yphA (yphA)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Bacillus subtilis Uncharacterized Protein YphA (UniProt ID: P50742) is a 297-amino acid protein expressed in E. coli with an N-terminal His-tag . Key structural and biochemical properties include:

PropertySpecification
Molecular Weight~34 kDa (calculated)
Purity>90% (SDS-PAGE verified)
Storage Conditions-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0); lyophilized powder
Reconstitution0.1–1.0 mg/mL in sterile water with 5–50% glycerol for stability

The full-length amino acid sequence is:
MSDYIYPIIAGVIAGIATRLYMLKTDYRQYPTYVHGKVIHIALGLIAAGLGAIIMPALLQEEFTAITFLTLAATQFRDVRNMERNTLTQMDSYELVSRGSTYIEGIAIAFESRNYIVIFTALLTTSAYVFLSIWAAVIAAVVCFLLAMKFMSGSVLKDIVDIEYIKPRFDGPGLFVDNIYMMNIGLPEKQELILKHGMGFILTPKNFNSAATIANLGQRQAILFDVSNVLGVYRDSGEPSLTPIAKRDLNDGRVAVFVLPQIHHPETAVQIISNVPTLENAIRMPTEFIKNQDKVIG .

Genetic Context and Functional Insights

YphA is encoded by the yphA gene (synonyms: BSU22850) located in the B. subtilis genome. Although initially identified as a σF-dependent sporulation-associated gene, deletion studies showed no impairment in sporulation or germination . Key findings:

  • Non-essentiality: Strains lacking codons 38–199 of yphA and 1–136 of yphB exhibited normal sporulation/germination .

  • Transcriptional Regulation: The yphA promoter region contains a σF-dependent transcriptional start site within a 550 bp upstream sequence .

  • Localization: YphA is hypothesized to interact with ribosomal complexes, potentially influencing rRNA/mRNA processing .

Expression Systems

FeatureB. subtilisE. coli
Endotoxin ProductionNoneHigh (requires purification)
Secretion EfficiencyHigh (Sec/Tat pathways) Moderate
Regulatory ApprovalGRAS/QPS status Limited for biomedical applications

Industrial Relevance

  • Biochemical Research: Used in SDS-PAGE for protein interaction studies .

  • Biotechnology: Serves as a model for optimizing secretion systems (e.g., Sec-dependent pathways) in B. subtilis .

Challenges and Future Directions

  • Functional Characterization: YphA remains uncharacterized mechanistically, necessitating structural studies (e.g., crystallography) to elucidate its role .

  • Production Optimization: Leveraging B. subtilis strains with protease deletions (e.g., WB800) could enhance yield .

  • Synthetic Biology: Integration of yphA into modular expression systems (e.g., IPTG-inducible or quorum-sensing promoters) may improve scalability .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirement.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. For dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference for your preparations.
Shelf Life
The shelf life is influenced by several factors including storage state, buffer composition, temperature, and the inherent stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to minimize freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
yphA; BSU22860; Uncharacterized protein YphA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yphA
Target Protein Sequence
MEQFYYYWSMWFLWVLTTFIFEKTKRRIAVSVFILTNIILSIHDIALYFSLNAAYLMFFV CGCVYAGYLGMYRFRYIMVYLTLVAAYAFVYLFALYDPVWFIIKPEWAAVILIVLLTASV ERNFEKQLVLFVLGMCQGELVYSFVIQKLAGAMAVGGFQWLNACSAGMILLFGISKYEHL ASQIGQKSKRSNKGATKMS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the YphA protein in Bacillus subtilis?

YphA is an uncharacterized protein found in Bacillus subtilis subsp. subtilis str. 168 with a sequence length of 199 amino acids. While its precise biological function remains undetermined, computational structure modeling suggests it possesses a defined tertiary structure with good confidence scores. Like many uncharacterized proteins in bacterial genomes, YphA represents an opportunity to discover novel biological functions that may contribute to B. subtilis physiology .

What is known about the predicted structure of YphA?

The structure of YphA has been computationally modeled using AlphaFold, yielding a model with a global pLDDT (predicted Local Distance Difference Test) score of 85.45, indicating a confident prediction for most of the protein's structure. The model (AF-P50741-F1) was released in AlphaFold DB on December 9, 2021, and last modified on September 30, 2022. The confidence scores vary across different regions of the protein, with some segments showing very high confidence (pLDDT > 90) while others display medium confidence (70 < pLDDT ≤ 90) .

Table 1: YphA Structure Prediction Metrics

ParameterValue
AlphaFold Model IDAF-P50741-F1
Global pLDDT Score85.45
Sequence Length199 amino acids
Confidence CategoriesVery high (pLDDT > 90)
Confident (70 < pLDDT ≤ 90)
Low (50 < pLDDT ≤ 70)
Very low (pLDDT ≤ 50)
UniProtKB IDP50741

How should researchers interpret AlphaFold predictions for YphA?

When working with AlphaFold models of uncharacterized proteins like YphA, researchers should consider the pLDDT score as a measure of prediction reliability. For YphA, with a global pLDDT of 85.45, most of the structure can be considered reliable, but experimental validation remains essential. Regions with pLDDT scores below 70 may be intrinsically disordered or adopt multiple conformations in solution. The model provides a starting point for hypothesis generation about potential binding sites, functional domains, and structural motifs, but should be interpreted cautiously without experimental verification .

What expression systems are recommended for recombinant YphA production?

For recombinant expression of B. subtilis proteins like YphA, several expression systems can be considered. E. coli remains the most common host for initial characterization, with BL21(DE3) or its derivatives often providing good yields for cytoplasmic proteins. For a B. subtilis protein like YphA, using B. subtilis itself as an expression host may offer advantages for proper folding and potential post-translational modifications. When expressing YphA, researchers should consider fusion tags (His6, GST, or MBP) to facilitate purification and potentially enhance solubility, while also implementing optimization strategies for temperature, induction conditions, and media composition .

How can I design knockout experiments to investigate YphA's function?

When designing knockout experiments for YphA in B. subtilis, consider both direct gene deletion and complementation strategies. The preferred approach would utilize a clean deletion method, similar to those implemented for other B. subtilis genes such as in studies of YngB function . The procedure should include:

  • Construction of a deletion vector containing upstream and downstream flanking regions of yphA

  • Transformation into B. subtilis 168 with selection for appropriate antibiotic markers

  • PCR verification of successful gene deletion

  • Complementation with yphA under its native or an inducible promoter

For phenotypic analysis, examine growth characteristics under various conditions (different carbon sources, stress conditions, anaerobic growth) similar to studies conducted for YngB, where function was revealed specifically under anaerobic conditions . Additionally, assess potential morphological changes using microscopy and potential effects on cell wall components, as many uncharacterized proteins in B. subtilis have roles in cell envelope processes .

What techniques are most suitable for studying YphA's potential enzymatic activity?

To investigate possible enzymatic functions of YphA, a multi-faceted approach is recommended. Begin with bioinformatic analyses to identify potential catalytic residues or substrate-binding domains based on the AlphaFold structural model. For in vitro enzymatic assays, purify recombinant YphA and screen against various substrate classes based on structural similarities to characterized enzymes.

For example, the approach used to characterize YngB's UGPase activity could serve as a model, where both in vitro assays with purified protein and complementation tests in deletion strains were employed . Specifically, YngB's activity was assessed using UTP and glucose-1-phosphate as substrates, with product formation monitored using appropriate analytical methods . For YphA, develop similar targeted assays based on bioinformatic predictions, and consider high-throughput substrate screening approaches if no clear function emerges from targeted assays.

What structural features can be inferred from YphA's AlphaFold model?

Researchers should examine the model for structural motifs that match known functional domains, potential active site configurations, surface electrostatic properties, and conserved residues mapped onto the structure. While the AlphaFold model has no experimental verification, the relatively high global pLDDT score (85.45) suggests it provides a reasonable starting point for structure-based hypotheses about YphA's function .

How can I validate the predicted structural model of YphA experimentally?

Experimental validation of YphA's predicted structure should employ multiple complementary approaches:

  • Circular Dichroism (CD) Spectroscopy: Verify the secondary structure composition predicted by AlphaFold.

  • Limited Proteolysis: Identify domain boundaries and regions of structural flexibility.

  • SAXS (Small-Angle X-ray Scattering): Obtain low-resolution structural information in solution to compare with the AlphaFold model.

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): Map regions of structural flexibility and solvent accessibility.

  • NMR Spectroscopy: For detailed structural validation if protein size allows.

  • X-ray Crystallography: The gold standard for structural determination, though crystallization of uncharacterized proteins can be challenging.

Similar approaches have been successfully applied to validate other B. subtilis proteins, such as YngB, where structural analysis revealed features characteristic of functional UGPases, which was subsequently confirmed by enzymatic activity testing .

How is the expression of yphA regulated in B. subtilis?

While specific data on yphA regulation is limited in the provided search results, we can draw parallels with other uncharacterized B. subtilis proteins that were initially considered non-functional under standard laboratory conditions. For example, YngB was found to be specifically expressed under anaerobic conditions, despite being dispensable during aerobic growth . This suggests that yphA might similarly be regulated by specific environmental conditions not routinely tested in laboratory settings.

To investigate yphA regulation, researchers should:

  • Analyze the promoter region for known regulatory elements

  • Construct transcriptional fusions (yphA promoter with reporter genes like lacZ or gfp)

  • Monitor expression under various conditions including different:

    • Growth phases

    • Nutrient availability

    • Stress conditions (oxidative, heat, pH, osmotic)

    • Oxygen availability (aerobic vs. anaerobic)

    • Growth temperatures

The approach used for YngB, where function was revealed specifically during anaerobic growth , demonstrates how environmental conditions can dramatically affect the expression and physiological relevance of seemingly non-essential genes in B. subtilis.

What genomic context clues might help predict YphA's function?

Genomic context analysis can provide valuable insights into the potential function of uncharacterized proteins like YphA. Examining the organization of genes surrounding yphA in the B. subtilis genome may reveal functional relationships through operonic structures, shared regulatory elements, or functional coupling with neighboring genes.

Drawing parallels from the analysis of other B. subtilis proteins, such as the yngABC operon that includes yngB , researchers should:

  • Identify whether yphA is part of an operon or transcriptional unit

  • Examine the functions of neighboring genes for potential functional relationships

  • Analyze gene conservation and synteny across related bacterial species

  • Look for co-occurrence patterns with other genes across diverse genomes

Understanding genomic context has proven valuable in elucidating the function of previously uncharacterized proteins in B. subtilis, as demonstrated by the discovery that YngB functions specifically under anaerobic conditions based on its operon structure and regulation .

How can I use interactomics approaches to identify YphA's functional network?

Identifying protein-protein interactions is a powerful strategy for elucidating the function of uncharacterized proteins like YphA. For comprehensive interactomics analysis, implement the following methodological approach:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express YphA with an affinity tag (His, FLAG, or streptavidin) in B. subtilis

    • Perform pulldown experiments under native conditions

    • Identify co-purified proteins using mass spectrometry

    • Include appropriate controls to filter out non-specific interactions

  • Bacterial Two-Hybrid Screening:

    • Construct a B. subtilis genomic library in a two-hybrid reporter strain

    • Screen for interactions with YphA as bait

    • Validate positive interactions with directed assays

  • Proximity-Dependent Labeling:

    • Express YphA fused to BioID or APEX2 in B. subtilis

    • Allow proximity-dependent biotinylation of neighboring proteins

    • Isolate biotinylated proteins and identify by mass spectrometry

  • Co-evolutionary Analysis:

    • Identify proteins that show correlated evolutionary patterns with YphA

    • These often represent functional partners or pathway components

  • In vivo Crosslinking:

    • Perform formaldehyde or UV crosslinking in living B. subtilis cells

    • Immunoprecipitate YphA and identify crosslinked partners

Similar approaches have proven successful in characterizing other proteins in B. subtilis, such as the RicAFT complex, where protein-protein interactions were essential to understanding their role in developmental processes and RNA maturation .

What computational methods can help predict YphA's potential ligands or substrates?

For predicting potential ligands or substrates of YphA, implement a multi-layered computational approach:

  • Structure-Based Virtual Screening:

    • Use the AlphaFold model of YphA to identify potential binding pockets

    • Perform molecular docking of metabolite libraries against these pockets

    • Prioritize compounds based on predicted binding energies and pose conservation

  • Binding Site Comparison:

    • Compare predicted binding pockets in YphA with characterized proteins

    • Identify structural similarities that might suggest similar ligand preferences

  • Molecular Dynamics Simulations:

    • Simulate YphA dynamics to identify transient binding pockets

    • Evaluate stability of predicted protein-ligand complexes

  • Genomic and Metabolic Context Analysis:

    • Analyze metabolic pathways associated with genes co-regulated with yphA

    • Identify metabolites from these pathways as candidate substrates

  • Machine Learning Approaches:

    • Apply trained models that predict protein-ligand interactions based on sequence and structural features

This multi-faceted approach has shown success in predicting functions of uncharacterized proteins, including those in B. subtilis, where structure-based analysis helped identify enzymatic activities that were subsequently verified experimentally .

How can I resolve contradictory experimental data about YphA's function?

When faced with contradictory experimental data about YphA's function, a systematic troubleshooting and validation approach is essential:

  • Methodological Assessment:

    • Critically evaluate experimental conditions across contradictory studies

    • Identify variables that might explain discrepancies (temperature, pH, buffer composition, etc.)

    • Standardize methods to enable direct comparison

  • Strain Background Effects:

    • Test whether genetic background influences YphA phenotypes

    • Create clean deletions in multiple reference strains of B. subtilis

    • Consider potential suppressor mutations that may mask phenotypes

  • Condition-Dependent Function:

    • Systematically test function under diverse conditions, as YphA may, like YngB, only be active under specific environmental conditions (e.g., anaerobic growth)

    • Design experiments that vary oxygen availability, carbon sources, and stress conditions

  • Multiple Functional Readouts:

    • Implement diverse assays measuring different aspects of YphA function

    • Combine genetic, biochemical, and physiological approaches

    • Use both in vivo and in vitro systems to bridge contradictions

  • Collaborative Cross-Validation:

    • Establish collaborations with other labs to independently verify results

    • Exchange materials (strains, plasmids, protein preparations) to eliminate lab-specific variables

This approach draws on strategies used to resolve functional ambiguities for other B. subtilis proteins, such as the Ric proteins, where multiple experimental approaches ultimately revealed their roles in RNA maturation and developmental processes .

What high-throughput methods can accelerate YphA functional analysis?

High-throughput approaches can significantly accelerate the functional characterization of uncharacterized proteins like YphA. Based on recent advances in protein function analysis, consider implementing:

  • Multiplexed Phenotype Screening:

    • Create a library of growth conditions (carbon sources, stress factors, antibiotics)

    • Measure growth profiles of wild-type vs. ΔyphA strains across all conditions

    • Apply principal component analysis to identify condition-specific phenotypes

  • Protein Stability Profiling:

    • Utilize high-throughput stability measurement methods like cDNA display proteolysis, which can measure folding stability for hundreds of thousands of protein variants

    • Create and screen YphA variants to map stability determinants

    • Correlate stability changes with potential functional residues

  • Transcriptome Analysis:

    • Perform RNA-seq comparing wild-type and ΔyphA strains under multiple conditions

    • Identify genes differentially expressed upon yphA deletion

    • Use gene set enrichment analysis to identify affected pathways

  • Metabolomics Screening:

    • Compare metabolite profiles between wild-type and ΔyphA strains

    • Identify accumulated or depleted metabolites that may represent substrates or products

  • Chemical Genomics:

    • Screen chemical libraries for compounds with differential effects on wild-type vs. ΔyphA strains

    • Identify chemical-genetic interactions that suggest function

The cDNA display proteolysis method described in search result represents a particularly powerful approach for analyzing protein stability at unprecedented scale, allowing measurement of thermodynamic folding stability for hundreds of thousands of protein domains in a single experiment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.