Recombinant Bacillus subtilis Uncharacterized Protein YphA (UniProt ID: P50742) is a 297-amino acid protein expressed in E. coli with an N-terminal His-tag . Key structural and biochemical properties include:
The full-length amino acid sequence is:
MSDYIYPIIAGVIAGIATRLYMLKTDYRQYPTYVHGKVIHIALGLIAAGLGAIIMPALLQEEFTAITFLTLAATQFRDVRNMERNTLTQMDSYELVSRGSTYIEGIAIAFESRNYIVIFTALLTTSAYVFLSIWAAVIAAVVCFLLAMKFMSGSVLKDIVDIEYIKPRFDGPGLFVDNIYMMNIGLPEKQELILKHGMGFILTPKNFNSAATIANLGQRQAILFDVSNVLGVYRDSGEPSLTPIAKRDLNDGRVAVFVLPQIHHPETAVQIISNVPTLENAIRMPTEFIKNQDKVIG .
YphA is encoded by the yphA gene (synonyms: BSU22850) located in the B. subtilis genome. Although initially identified as a σF-dependent sporulation-associated gene, deletion studies showed no impairment in sporulation or germination . Key findings:
Non-essentiality: Strains lacking codons 38–199 of yphA and 1–136 of yphB exhibited normal sporulation/germination .
Transcriptional Regulation: The yphA promoter region contains a σF-dependent transcriptional start site within a 550 bp upstream sequence .
Localization: YphA is hypothesized to interact with ribosomal complexes, potentially influencing rRNA/mRNA processing .
Biochemical Research: Used in SDS-PAGE for protein interaction studies .
Biotechnology: Serves as a model for optimizing secretion systems (e.g., Sec-dependent pathways) in B. subtilis .
Functional Characterization: YphA remains uncharacterized mechanistically, necessitating structural studies (e.g., crystallography) to elucidate its role .
Production Optimization: Leveraging B. subtilis strains with protease deletions (e.g., WB800) could enhance yield .
Synthetic Biology: Integration of yphA into modular expression systems (e.g., IPTG-inducible or quorum-sensing promoters) may improve scalability .
KEGG: bsu:BSU22860
STRING: 224308.Bsubs1_010100012561
YphA is an uncharacterized protein found in Bacillus subtilis subsp. subtilis str. 168 with a sequence length of 199 amino acids. While its precise biological function remains undetermined, computational structure modeling suggests it possesses a defined tertiary structure with good confidence scores. Like many uncharacterized proteins in bacterial genomes, YphA represents an opportunity to discover novel biological functions that may contribute to B. subtilis physiology .
The structure of YphA has been computationally modeled using AlphaFold, yielding a model with a global pLDDT (predicted Local Distance Difference Test) score of 85.45, indicating a confident prediction for most of the protein's structure. The model (AF-P50741-F1) was released in AlphaFold DB on December 9, 2021, and last modified on September 30, 2022. The confidence scores vary across different regions of the protein, with some segments showing very high confidence (pLDDT > 90) while others display medium confidence (70 < pLDDT ≤ 90) .
Table 1: YphA Structure Prediction Metrics
| Parameter | Value |
|---|---|
| AlphaFold Model ID | AF-P50741-F1 |
| Global pLDDT Score | 85.45 |
| Sequence Length | 199 amino acids |
| Confidence Categories | Very high (pLDDT > 90) Confident (70 < pLDDT ≤ 90) Low (50 < pLDDT ≤ 70) Very low (pLDDT ≤ 50) |
| UniProtKB ID | P50741 |
When working with AlphaFold models of uncharacterized proteins like YphA, researchers should consider the pLDDT score as a measure of prediction reliability. For YphA, with a global pLDDT of 85.45, most of the structure can be considered reliable, but experimental validation remains essential. Regions with pLDDT scores below 70 may be intrinsically disordered or adopt multiple conformations in solution. The model provides a starting point for hypothesis generation about potential binding sites, functional domains, and structural motifs, but should be interpreted cautiously without experimental verification .
For recombinant expression of B. subtilis proteins like YphA, several expression systems can be considered. E. coli remains the most common host for initial characterization, with BL21(DE3) or its derivatives often providing good yields for cytoplasmic proteins. For a B. subtilis protein like YphA, using B. subtilis itself as an expression host may offer advantages for proper folding and potential post-translational modifications. When expressing YphA, researchers should consider fusion tags (His6, GST, or MBP) to facilitate purification and potentially enhance solubility, while also implementing optimization strategies for temperature, induction conditions, and media composition .
When designing knockout experiments for YphA in B. subtilis, consider both direct gene deletion and complementation strategies. The preferred approach would utilize a clean deletion method, similar to those implemented for other B. subtilis genes such as in studies of YngB function . The procedure should include:
Construction of a deletion vector containing upstream and downstream flanking regions of yphA
Transformation into B. subtilis 168 with selection for appropriate antibiotic markers
PCR verification of successful gene deletion
Complementation with yphA under its native or an inducible promoter
For phenotypic analysis, examine growth characteristics under various conditions (different carbon sources, stress conditions, anaerobic growth) similar to studies conducted for YngB, where function was revealed specifically under anaerobic conditions . Additionally, assess potential morphological changes using microscopy and potential effects on cell wall components, as many uncharacterized proteins in B. subtilis have roles in cell envelope processes .
To investigate possible enzymatic functions of YphA, a multi-faceted approach is recommended. Begin with bioinformatic analyses to identify potential catalytic residues or substrate-binding domains based on the AlphaFold structural model. For in vitro enzymatic assays, purify recombinant YphA and screen against various substrate classes based on structural similarities to characterized enzymes.
For example, the approach used to characterize YngB's UGPase activity could serve as a model, where both in vitro assays with purified protein and complementation tests in deletion strains were employed . Specifically, YngB's activity was assessed using UTP and glucose-1-phosphate as substrates, with product formation monitored using appropriate analytical methods . For YphA, develop similar targeted assays based on bioinformatic predictions, and consider high-throughput substrate screening approaches if no clear function emerges from targeted assays.
Researchers should examine the model for structural motifs that match known functional domains, potential active site configurations, surface electrostatic properties, and conserved residues mapped onto the structure. While the AlphaFold model has no experimental verification, the relatively high global pLDDT score (85.45) suggests it provides a reasonable starting point for structure-based hypotheses about YphA's function .
Experimental validation of YphA's predicted structure should employ multiple complementary approaches:
Circular Dichroism (CD) Spectroscopy: Verify the secondary structure composition predicted by AlphaFold.
Limited Proteolysis: Identify domain boundaries and regions of structural flexibility.
SAXS (Small-Angle X-ray Scattering): Obtain low-resolution structural information in solution to compare with the AlphaFold model.
HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): Map regions of structural flexibility and solvent accessibility.
NMR Spectroscopy: For detailed structural validation if protein size allows.
X-ray Crystallography: The gold standard for structural determination, though crystallization of uncharacterized proteins can be challenging.
Similar approaches have been successfully applied to validate other B. subtilis proteins, such as YngB, where structural analysis revealed features characteristic of functional UGPases, which was subsequently confirmed by enzymatic activity testing .
While specific data on yphA regulation is limited in the provided search results, we can draw parallels with other uncharacterized B. subtilis proteins that were initially considered non-functional under standard laboratory conditions. For example, YngB was found to be specifically expressed under anaerobic conditions, despite being dispensable during aerobic growth . This suggests that yphA might similarly be regulated by specific environmental conditions not routinely tested in laboratory settings.
To investigate yphA regulation, researchers should:
Analyze the promoter region for known regulatory elements
Construct transcriptional fusions (yphA promoter with reporter genes like lacZ or gfp)
Monitor expression under various conditions including different:
Growth phases
Nutrient availability
Stress conditions (oxidative, heat, pH, osmotic)
Oxygen availability (aerobic vs. anaerobic)
Growth temperatures
The approach used for YngB, where function was revealed specifically during anaerobic growth , demonstrates how environmental conditions can dramatically affect the expression and physiological relevance of seemingly non-essential genes in B. subtilis.
Genomic context analysis can provide valuable insights into the potential function of uncharacterized proteins like YphA. Examining the organization of genes surrounding yphA in the B. subtilis genome may reveal functional relationships through operonic structures, shared regulatory elements, or functional coupling with neighboring genes.
Drawing parallels from the analysis of other B. subtilis proteins, such as the yngABC operon that includes yngB , researchers should:
Identify whether yphA is part of an operon or transcriptional unit
Examine the functions of neighboring genes for potential functional relationships
Analyze gene conservation and synteny across related bacterial species
Look for co-occurrence patterns with other genes across diverse genomes
Understanding genomic context has proven valuable in elucidating the function of previously uncharacterized proteins in B. subtilis, as demonstrated by the discovery that YngB functions specifically under anaerobic conditions based on its operon structure and regulation .
Identifying protein-protein interactions is a powerful strategy for elucidating the function of uncharacterized proteins like YphA. For comprehensive interactomics analysis, implement the following methodological approach:
Affinity Purification-Mass Spectrometry (AP-MS):
Express YphA with an affinity tag (His, FLAG, or streptavidin) in B. subtilis
Perform pulldown experiments under native conditions
Identify co-purified proteins using mass spectrometry
Include appropriate controls to filter out non-specific interactions
Bacterial Two-Hybrid Screening:
Construct a B. subtilis genomic library in a two-hybrid reporter strain
Screen for interactions with YphA as bait
Validate positive interactions with directed assays
Proximity-Dependent Labeling:
Express YphA fused to BioID or APEX2 in B. subtilis
Allow proximity-dependent biotinylation of neighboring proteins
Isolate biotinylated proteins and identify by mass spectrometry
Co-evolutionary Analysis:
Identify proteins that show correlated evolutionary patterns with YphA
These often represent functional partners or pathway components
In vivo Crosslinking:
Perform formaldehyde or UV crosslinking in living B. subtilis cells
Immunoprecipitate YphA and identify crosslinked partners
Similar approaches have proven successful in characterizing other proteins in B. subtilis, such as the RicAFT complex, where protein-protein interactions were essential to understanding their role in developmental processes and RNA maturation .
For predicting potential ligands or substrates of YphA, implement a multi-layered computational approach:
Structure-Based Virtual Screening:
Use the AlphaFold model of YphA to identify potential binding pockets
Perform molecular docking of metabolite libraries against these pockets
Prioritize compounds based on predicted binding energies and pose conservation
Binding Site Comparison:
Compare predicted binding pockets in YphA with characterized proteins
Identify structural similarities that might suggest similar ligand preferences
Molecular Dynamics Simulations:
Simulate YphA dynamics to identify transient binding pockets
Evaluate stability of predicted protein-ligand complexes
Genomic and Metabolic Context Analysis:
Analyze metabolic pathways associated with genes co-regulated with yphA
Identify metabolites from these pathways as candidate substrates
Machine Learning Approaches:
Apply trained models that predict protein-ligand interactions based on sequence and structural features
This multi-faceted approach has shown success in predicting functions of uncharacterized proteins, including those in B. subtilis, where structure-based analysis helped identify enzymatic activities that were subsequently verified experimentally .
When faced with contradictory experimental data about YphA's function, a systematic troubleshooting and validation approach is essential:
Methodological Assessment:
Critically evaluate experimental conditions across contradictory studies
Identify variables that might explain discrepancies (temperature, pH, buffer composition, etc.)
Standardize methods to enable direct comparison
Strain Background Effects:
Test whether genetic background influences YphA phenotypes
Create clean deletions in multiple reference strains of B. subtilis
Consider potential suppressor mutations that may mask phenotypes
Condition-Dependent Function:
Multiple Functional Readouts:
Implement diverse assays measuring different aspects of YphA function
Combine genetic, biochemical, and physiological approaches
Use both in vivo and in vitro systems to bridge contradictions
Collaborative Cross-Validation:
Establish collaborations with other labs to independently verify results
Exchange materials (strains, plasmids, protein preparations) to eliminate lab-specific variables
This approach draws on strategies used to resolve functional ambiguities for other B. subtilis proteins, such as the Ric proteins, where multiple experimental approaches ultimately revealed their roles in RNA maturation and developmental processes .
High-throughput approaches can significantly accelerate the functional characterization of uncharacterized proteins like YphA. Based on recent advances in protein function analysis, consider implementing:
Multiplexed Phenotype Screening:
Create a library of growth conditions (carbon sources, stress factors, antibiotics)
Measure growth profiles of wild-type vs. ΔyphA strains across all conditions
Apply principal component analysis to identify condition-specific phenotypes
Protein Stability Profiling:
Transcriptome Analysis:
Perform RNA-seq comparing wild-type and ΔyphA strains under multiple conditions
Identify genes differentially expressed upon yphA deletion
Use gene set enrichment analysis to identify affected pathways
Metabolomics Screening:
Compare metabolite profiles between wild-type and ΔyphA strains
Identify accumulated or depleted metabolites that may represent substrates or products
Chemical Genomics:
Screen chemical libraries for compounds with differential effects on wild-type vs. ΔyphA strains
Identify chemical-genetic interactions that suggest function
The cDNA display proteolysis method described in search result represents a particularly powerful approach for analyzing protein stability at unprecedented scale, allowing measurement of thermodynamic folding stability for hundreds of thousands of protein domains in a single experiment .