Recombinant Bacillus subtilis Uncharacterized protein ypjA (ypjA)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Sequence

The full-length YpjA protein spans 185 amino acids (AA) with a molecular weight of ~21 kDa (calculated from AA sequence) . Key structural features include:

FeatureDetails
Amino Acid SequenceMLILVLAINFLGTVYGYYWYLPQLLETPARFLIFVPDSPTATFFFLFVLLAFLMKRNAPLLEALALVTLVKYGLWAVAMNFLVLAVTGDLPWEGYMLIASHFAMAVQGVLYSPYFRFSFWHLAIAAVWTLHNDVIDYLFDMMPQYSMLSDYMTEIGYGTFWLSIFSIALAYFLVVSKKQT KLELM
Expression HostE. coli (reported in commercial products) ; B. subtilis (hypothesized for secretion systems)
TagN-terminal His-tag (facilitates purification via metal affinity chromatography)
Purity>90% (SDS-PAGE validated)

Expression Systems and Host Considerations

While B. subtilis is widely used for recombinant protein production due to its GRAS status, endotoxin-free secretion, and high-yield fermentation , current commercial YpjA products are expressed in E. coli . This discrepancy highlights potential challenges in heterologous expression.

Key Advantages of B. subtilis for Recombinant Proteins

ParameterB. subtilisE. coli (for comparison)
Secretion EfficiencyUtilizes Sec-dependent and Tat-dependent pathways for extracellular release Limited secretion; cytoplasmic retention common
Protein FoldingPrsA lipoprotein assists folding; chaperones reduce proteolysis Requires co-expression of chaperones for proper folding
Fermentation SpeedDoubling time: ~20 minutes (vs. 2–3 hours for E. coli) Slower growth; longer fermentation cycles
Endotoxin ContentNone (GRAS/QPS status) High endotoxin levels requiring costly purification

Though no direct studies on YpjA exist, its recombinant production aligns with broader B. subtilis applications:

  1. Structural Biology: His-tagged YpjA enables X-ray crystallography/NMR studies .

  2. Biotechnology: B. subtilis’s secretion systems could optimize YpjA production for industrial enzymes or bioactive molecules .

  3. Vaccine Development: B. subtilis’s ability to induce immune responses (e.g., SIgA production) suggests potential for antigen delivery .

Challenges and Future Directions

  • Functional Annotation: YpjA’s role in B. subtilis physiology remains undefined, limiting targeted applications.

  • Expression Optimization: Leveraging B. subtilis’s self-inducing promoters (e.g., Pgrac) or codon-optimized genes could enhance yield .

  • Protease Resistance: B. subtilis’s native proteases may degrade recombinant proteins; protease-deficient strains (e.g., WB800N) could mitigate this .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we will prioritize developing a specified tag if you provide requirements.
Synonyms
ypjA; BSU22530; Uncharacterized protein YpjA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
ypjA
Target Protein Sequence
MLILVLAINFLGTVYGYYWYLPQLLETPARFLIFVPDSPTATFFFLFVLLAFLMKRNAPL LEALALVTLVKYGLWAVAMNFLVLAVTGDLPWEGYMLIASHFAMAVQGVLYSPYFRFSFW HLAIAAVWTLHNDVIDYLFDMMPQYSMLSDYMTEIGYGTFWLSIFSIALAYFLVVSKKQT KLELM
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of YpjA protein?

YpjA appears to be an uncharacterized outer membrane protein in Bacillus subtilis with predicted structural features similar to those found in autotransporter proteins. Computational structure modeling using AlphaFold has generated a high-confidence model (pLDDT global score: 91.49) available in the RCSB PDB (AF-P52143-F1) . The predicted protein contains:

  • 1,526 amino acid residues

  • Molecular weight of approximately 157,498 Da

  • A β-helical structural motif common to autotransporter proteins (Type 1 β-helical passenger architecture)

For experimental structural characterization, researchers should consider:

  • X-ray crystallography of the purified protein

  • Cryo-electron microscopy for visualization of membrane integration

  • Limited proteolysis combined with mass spectrometry to identify domain boundaries

What expression systems are most suitable for recombinant YpjA production?

Multiple expression systems have been validated for YpjA production, each with advantages for different research applications:

Expression SystemYieldTurnaround TimePost-translational ModificationsBest Applications
E. coliHighShort (2-3 days)LimitedStructural studies, antibody production
YeastHighModerate (3-5 days)Moderate capabilityFunctional studies requiring some PTMs
Insect cellsModerateLong (7-10 days)Good capabilityStudies requiring complex folding
Mammalian cellsLowerLongest (10-14 days)Highest fidelityActivity studies where native folding is critical

For optimal expression, consider that YpjA is an outer membrane protein, which may require specialized approaches:

  • Use of detergents for solubilization

  • Lower induction temperatures (16-25°C) to improve folding

  • Co-expression with chaperones to enhance proper folding

How does YpjA relate to bacterial autotransporter classification?

YpjA appears to belong to Group 4 autotransporters, which are associated with biofilm formation. This classification is based on:

  • Phylogenetic analyses placing YpjA in proximity to prototypical self-associating autotransporters (SAATs) like Ag43, Cah, TibA, and AIDA-I from E. coli

  • Predicted β-helical structure along the full length of the passenger domain, consistent with Type 1 autotransporter structure

  • Functional associations with biofilm formation similar to other Group 4 members

Although YpjA is mentioned in the context of Group 4 autotransporters, it should be noted that B. subtilis is typically considered a Gram-positive bacterium without a true outer membrane, which creates an interesting contradiction regarding YpjA's classification as an "outer membrane protein" . This represents an area requiring further research to resolve.

What methods can resolve contradictions about YpjA's subcellular localization?

The literature presents a contradiction regarding YpjA: some sources describe it as an "outer membrane protein" , yet Bacillus subtilis is generally classified as a Gram-positive bacterium that lacks a typical outer membrane . To resolve this contradiction, researchers should consider:

Methodological approaches:

  • Subcellular fractionation combined with Western blotting using anti-YpjA antibodies

  • Immunogold electron microscopy to precisely localize YpjA in B. subtilis cells

  • Fluorescent protein tagging (GFP/mCherry) of YpjA for live-cell microscopy

  • Protease accessibility assays to determine surface exposure

  • Investigation of potential association with the Gram-positive cell envelope components:

    • Peptidoglycan layer

    • Teichoic acids

    • S-layer proteins

Critical consideration: Some Firmicutes have been reported to possess structures resembling an outer membrane despite being classified as Gram-positive . This fundamental evolutionary question remains unresolved and YpjA's characterization may contribute to understanding this apparent contradiction.

How might YpjA contribute to biofilm formation in B. subtilis?

Based on its phylogenetic proximity to Group 4 autotransporters associated with biofilm formation, YpjA may play a role similar to other SAATs. While direct experimental evidence for YpjA's role in biofilm formation is limited, related research suggests several potential mechanisms:

  • Self-association mechanism: Similar to Ag43, YpjA might mediate bacterial aggregation through Velcro-like interactions between adjacent cells

  • Matrix component production: Similar to YpqP (a different B. subtilis protein), YpjA might be involved in the synthesis of extracellular polymeric substances

  • Adhesion to surfaces: YpjA may function like UpaB in E. coli, binding to environmental surfaces to initiate biofilm formation

Experimental approaches to investigate this function:

  • Creation of ypjA deletion mutants and assessment of biofilm formation capacity

  • Complementation studies with wildtype and mutant variants

  • Confocal laser scanning microscopy of biofilms formed by wildtype vs. ΔypjA strains

  • Dual-species biofilm assays to test interspecies interactions

  • Atomic force microscopy to measure cell-cell adhesion forces

What analytical techniques are most appropriate for functional characterization of YpjA?

Given YpjA's uncharacterized status, a comprehensive approach combining multiple techniques is recommended:

Genomic approaches:

  • Comparative genomics across Bacillus species to identify conserved domains

  • Transcriptomic analysis (RNA-seq) to determine expression patterns under different conditions

  • Suppressor screening to identify genetic interactions

Biochemical approaches:

  • Pull-down assays to identify protein-protein interactions

  • Surface plasmon resonance to measure binding affinities to potential substrates

  • Enzymatic activity assays based on predicted functions

  • Glycan binding arrays if adhesion properties are suspected

Structural approaches:

  • Hydrogen-deuterium exchange mass spectrometry to identify flexible/interaction regions

  • Single-particle cryo-EM for structural determination if crystallization proves challenging

  • NMR spectroscopy for dynamics studies of specific domains

Cellular approaches:

  • Biofilm assays comparing wildtype and mutant strains

  • Cell adhesion assays to various surfaces and host cells

  • Bacterial two-hybrid screening to identify interaction partners

How does YpjA compare to YpqP in terms of biofilm-related functions?

While YpjA and YpqP are different proteins in B. subtilis, comparing their potential roles in biofilm formation provides valuable research context:

FeatureYpjAYpqP
FunctionUncharacterized, potentially involved in biofilm formation based on classification Confirmed biofilm determinant, required for thick-biofilm formation on submerged surfaces
Biochemical activityUnknownPredicted UDP-N-acetylglucosamine 4,6-dehydratase; likely involved in polysaccharide synthesis
Impact when disruptedNot experimentally determinedLoss of three-dimensional structure in biofilms; decreased resistance to biocides
Multispecies interactionsUnknownMediates spatial arrangement and protection of S. aureus in mixed biofilms
DistributionUnknown across B. subtilis strainsFunctional in natural B. subtilis isolates; disrupted by SPβ prophage in laboratory strains 168 and NCIB3610

Research approach to investigate YpjA-YpqP relationships:

  • Generate single and double knockout mutants (ΔypjA, ΔypqP, and ΔypjAΔypqP)

  • Compare biofilm phenotypes and transcriptional profiles

  • Test for potential genetic interactions through complementation studies

  • Evaluate resistance to antimicrobial compounds in single vs. double mutants

What methodological considerations are important when designing experiments to study YpjA's role in interspecies interactions?

B. subtilis engages in complex social behaviors with both conspecifics and other bacterial species . When investigating YpjA's potential role in these interactions:

Experimental design considerations:

  • Strain selection:

    • Use natural isolates rather than laboratory strains when possible

    • Include strains known to form robust biofilms (like NDmed)

    • Consider strains with functional ypjA genes (verify genomic integrity)

  • Biofilm model selection:

    • Submerged biofilm models may be more relevant than pellicle models for certain interactions

    • Include both solid-liquid and liquid-air interfaces in comparative studies

  • Interspecies partner selection:

    • Include pathogenic species like S. aureus to assess protective effects

    • Consider ecological partners found in B. subtilis natural habitats (soil, plant rhizosphere)

  • Analytical methods:

    • Confocal laser scanning microscopy for spatial organization analysis

    • Viability testing after exposure to antimicrobials

    • Transcriptomics to identify differentially expressed genes in co-cultures

  • Controls:

    • Include YpqP mutants as comparative controls given their known biofilm-related phenotypes

    • Use B. subtilis strains with disrupted ypjA genes (if available) as negative controls

What purification strategies are most effective for recombinant YpjA?

As a large membrane protein (157.5 kDa) , YpjA presents significant purification challenges. Based on experiences with similar autotransporter proteins:

Recommended purification strategy:

  • Expression optimization:

    • Use C41(DE3) or C43(DE3) E. coli strains designed for membrane protein expression

    • Express at lower temperatures (16-20°C) to improve folding

    • Consider fusion tags that enhance solubility (MBP, SUMO)

  • Extraction optimization:

    • Test multiple detergents for solubilization (DDM, LDAO, Triton X-100)

    • Use mild solubilization conditions to maintain native structure

    • Consider native membrane extraction using styrene-maleic acid copolymers (SMALPs)

  • Purification steps:

    • Immobilized metal affinity chromatography (IMAC) as initial capture step

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

  • Quality control:

    • Circular dichroism to confirm secondary structure integrity

    • Dynamic light scattering to assess homogeneity

    • Thermal shift assays to evaluate stability in different buffer conditions

How can researchers design effective antibodies against YpjA for experimental applications?

Developing specific antibodies against YpjA requires careful epitope selection and validation:

Antibody development strategy:

  • Epitope selection approaches:

    • In silico analysis to identify surface-exposed regions

    • Focus on unique regions not conserved in related proteins

    • Consider both linear and conformational epitopes

  • Immunization approaches:

    • Use of recombinant fragments rather than full-length protein

    • Consider synthetic peptides corresponding to predicted epitopes

    • Multiple host species for polyclonal development (rabbit, chicken, goat)

  • Validation methods:

    • Western blotting against recombinant protein and native B. subtilis extracts

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence microscopy to confirm localization

    • Testing in ypjA knockout strains as negative controls

What are the most appropriate heterologous systems for studying YpjA function?

When native B. subtilis systems present limitations, heterologous expression can provide insights:

Recommended heterologous systems:

  • For adhesion studies:

    • E. coli K-12 strains lacking endogenous adhesins

    • Assessment of aggregation, biofilm formation, and surface attachment

  • For structural studies:

    • Specialized E. coli strains for membrane protein expression (C41/C43)

    • Cell-free expression systems for difficult-to-express domains

  • For interaction studies:

    • Yeast two-hybrid or bacterial two-hybrid systems

    • Reconstituted systems using liposomes or nanodiscs

  • For localization studies:

    • E. coli or B. subtilis strains with fluorescently tagged cellular compartments

    • Super-resolution microscopy to determine precise subcellular localization

Each system requires appropriate controls, including empty vector controls and expression of known proteins with similar characteristics.

How might YpjA contribute to B. subtilis' ecological roles?

B. subtilis is known to function as a plant growth promoter and forms associations with plant roots . Future research should investigate:

  • Plant-microbe interactions:

    • Does YpjA facilitate adhesion to plant surfaces?

    • Is YpjA involved in biofilm formation in the rhizosphere?

    • Does YpjA expression change in response to plant-derived signals?

  • Multispecies community dynamics:

    • How does YpjA affect B. subtilis interactions with soil microbiota?

    • Does YpjA contribute to competitive advantages in mixed communities?

    • Is YpjA involved in kin recognition mechanisms described in B. subtilis ?

Experimental approaches:

  • Plant-microbe co-culture systems

  • Rhizosphere simulation models

  • Transcriptomics under different ecological conditions

  • Comparison of wildtype and ypjA mutants in soil microcosms

What technological advances would facilitate better characterization of YpjA?

Several emerging technologies could advance our understanding of YpjA:

  • Structural biology innovations:

    • AlphaFold and other AI-based structure prediction tools for more accurate modeling

    • Advances in cryo-EM for membrane protein structures

    • Single-molecule techniques to study protein dynamics

  • Functional genomics approaches:

    • CRISPR-Cas9 for precise genome editing in B. subtilis

    • CRISPRi for conditional repression to study essential genes

    • High-throughput phenotyping of mutant libraries

  • Imaging innovations:

    • Super-resolution microscopy for tracking protein localization

    • Label-free imaging techniques to study native protein behavior

    • Advanced biofilm imaging platforms

  • Systems biology approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • Machine learning for prediction of protein-protein interactions

    • Computational modeling of biofilm formation

By applying these advanced technologies, researchers can develop a more comprehensive understanding of YpjA's structure, function, and role in B. subtilis biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.