Recombinant Bacillus subtilis Uncharacterized protein yqfD (yqfD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us; we will prioritize development of the specified tag.
Synonyms
yqfD; BSU25350; Uncharacterized protein YqfD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqfD
Target Protein Sequence
MKNKWLSFFSGKVQLELTGRGIERLLNECTRQGIPVFHVKKKKEAVSLYIQLQDVHAFRR VRSKFKCKARFINRKGFPFLLLKSKLNIGFTIGFAIFFILLFLLSNMVWKIDVTGAKPET EHQMRQHLNEIGVKKGRLQFLMMSPEKIQKSLTNGIDNITWVGVDLKGTTIHMKVVEKNE PEKEKYVSPRNIVAKKKATITRMFVQKGQPMAAIHDHVEKGQLLVSGLIGSEDHQQEVAS KAEIYGETWYRSEVTVPLETLFNVYTGKVRTKHKLSFGSLAIPIWGMTFKKEELKHPKTE QEKHSLHFLGFKLPVSYVKEQTRESEEALRKYTKEEAVQEGIKLGKQDVEDKIGENGEVK SEKVLHQTVENGKVKLIILYQVIEDIVQTTPIVRETEE
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the current characterization status of the yqfD protein in Bacillus subtilis?

The yqfD protein in B. subtilis is currently classified as an uncharacterized protein with similarity to UDP-glucose 4-epimerase. It is part of the σE regulon, which is activated during the sporulation process . While its exact function remains unknown, genetic screens have identified it as important during sporulation, with mutants showing some small spores with reduced σG activity . As with many hypothetical proteins, yqfD is predicted to be expressed, but its precise biological role is yet to be fully elucidated .

What structural and functional domains have been predicted for the yqfD protein?

Based on current bioinformatic analyses, yqfD shows similarity to UDP-glucose 4-epimerase, suggesting it may play a role in carbohydrate metabolism or cell wall synthesis . The complete structural characterization would typically involve identifying conserved domains, predicting secondary and tertiary structures, and analyzing binding sites . For hypothetical proteins like yqfD, computational approaches including homology modeling, conserved domain analysis, and binding site prediction are essential first steps before experimental validation . While specific structural data for yqfD is limited in the search results, the methodological approach would include using tools like NCBI's Conserved Domain Database, Pfam, and structure prediction software.

How is yqfD gene expression regulated during different growth phases of B. subtilis?

The yqfD gene is part of the σE regulon, indicating its expression is controlled by the sigma factor σE during sporulation . Sigma factors are key regulatory proteins that control gene expression by directing RNA polymerase to specific promoter sequences. In B. subtilis, σE becomes active in the mother cell compartment during the early stages of sporulation, suggesting that yqfD is expressed specifically during this developmental process . For comprehensive expression analysis, researchers should consider:

  • Time-course RNA-seq or qRT-PCR experiments comparing vegetative growth versus sporulation conditions

  • Reporter gene fusions (e.g., yqfD promoter fused to GFP) to visualize expression patterns

  • ChIP-seq experiments to confirm direct binding of σE to the yqfD promoter region

What are the optimal methods for cloning and expressing recombinant yqfD protein?

For recombinant expression of yqfD from B. subtilis, several approaches can be considered:

Expression System Selection:

  • For homologous expression, the optimized DegSU quorum sensing (QS) system in B. subtilis provides an autoinducible system for high-level recombinant protein expression . This system has been modified through promoter engineering and regulatory circuit optimization, increasing expression efficiency by over 100% .

  • For heterologous expression in E. coli, standard T7-based expression systems with appropriate codon optimization might be suitable.

Cloning Strategy:

  • Amplify the yqfD gene from B. subtilis genomic DNA using high-fidelity polymerase

  • Add appropriate restriction sites or use Gibson Assembly for seamless cloning

  • For the DegSU QS system, clone into vectors containing the optimized PaprE E742 promoter, which shows 118.3% increased strength compared to wild-type promoters

  • Include an appropriate affinity tag (His-tag, FLAG-tag) for purification

  • Consider using a signal peptide if secretion of the protein is desired

Expression Optimization:

  • Use a robust B. subtilis strain with knockouts of competitive target genes (sacB, amyE) and operons (pgs, srfA) as demonstrated for other recombinant proteins

  • Introduce degU L113F and degQ36 Hy variants to increase regulatory strength

  • Monitor protein expression using SDS-PAGE and Western blotting at different time points

What purification strategies are most effective for obtaining high-purity yqfD protein for biochemical studies?

Based on general practices for recombinant protein purification from B. subtilis:

Extraction Methods:

  • For intracellular expression: Cell lysis using sonication or mechanical disruption in appropriate buffer systems

  • For secreted expression: Direct purification from culture supernatant

Purification Protocol:

  • Initial capture using affinity chromatography (if tagged) or ion exchange chromatography

  • Secondary purification using size exclusion chromatography to remove aggregates and obtain homogeneous protein

  • Buffer optimization based on predicted physicochemical properties

Quality Control:

  • Assess purity using SDS-PAGE and mass spectrometry

  • Verify protein identity via western blotting and/or peptide mapping

  • Check for proper folding using circular dichroism or fluorescence spectroscopy

  • Verify activity using UDP-glucose 4-epimerase activity assays if the predicted function is correct

How can researchers generate and validate knockout or knockdown mutants of yqfD for functional studies?

Generation of yqfD Mutants:

  • CRISPR-Cas9 System:

    • Design guide RNAs targeting the yqfD gene

    • Develop a template for homology-directed repair with desired modifications

    • Transform into B. subtilis using established protocols

    • Screen transformants using PCR and sequencing

  • Traditional Homologous Recombination:

    • Create a construct with antibiotic resistance cassette flanked by yqfD homology regions

    • Transform into B. subtilis and select on appropriate antibiotics

    • Confirm integration via PCR and sequencing

Validation Methods:

  • Molecular Validation:

    • PCR verification of gene disruption

    • RT-PCR or RNA-seq to confirm absence of yqfD transcripts

    • Western blotting to confirm absence of protein (requires specific antibodies)

  • Phenotypic Characterization:

    • Analyze sporulation efficiency (based on the known 0% sporulation efficiency in yqfD mutants )

    • Examine spore morphology by microscopy (looking for small spores with reduced σG activity )

    • Conduct growth curve analysis under different conditions

  • Complementation Studies:

    • Reintroduce wild-type yqfD under an inducible promoter

    • Verify restoration of wild-type phenotype

How does the function of yqfD relate to the UDP-glucose 4-epimerase activity and what experimental approaches can confirm this prediction?

The similarity of yqfD to UDP-glucose 4-epimerase suggests potential involvement in carbohydrate metabolism or cell wall synthesis . To investigate this connection:

Biochemical Characterization:

  • Express and purify recombinant yqfD protein

  • Perform enzymatic assays using UDP-glucose as substrate

  • Monitor conversion to UDP-galactose using HPLC, mass spectrometry, or coupled enzymatic assays

  • Compare kinetic parameters with known UDP-glucose 4-epimerases

Structural Studies:

  • Determine crystal structure or conduct NMR analysis

  • Compare active site architecture with characterized UDP-glucose 4-epimerases

  • Perform in silico docking studies with potential substrates

Metabolomic Analysis:

  • Compare metabolite profiles between wild-type and yqfD mutant strains

  • Focus on UDP-sugars and related metabolites

  • Use isotope-labeled precursors to track flux through relevant pathways

Data Analysis Table: Proposed Enzymatic Activity Assessment

ExperimentMethodExpected Outcome for Positive UDP-glucose 4-epimerase ActivityControls
Substrate specificityHPLC/MSConversion of UDP-glucose to UDP-galactoseKnown UDP-glucose 4-epimerase, no enzyme control
Cofactor requirementActivity assay with/without NAD+/NADHActivity dependent on NAD+/NADH presenceAssays with different cofactors
pH optimumActivity assays at pH 5.0-9.0Bell-shaped curve with defined optimumMultiple buffer systems
Temperature sensitivityActivity assays at 25-60°CTemperature-dependent activity profileHeat-inactivated enzyme

What is the role of yqfD in B. subtilis sporulation and how does it interact with the σE and σG regulatory networks?

Based on the genetic screen data, yqfD mutation results in small spores with reduced σG activity , suggesting a role in the sporulation regulatory cascade:

Transcriptional Analysis:

  • Perform RNA-seq comparing wild-type and yqfD mutant strains during sporulation

  • Identify differentially expressed genes, particularly those in the σE and σG regulons

  • Use qRT-PCR to validate key changes in gene expression

Protein-Protein Interactions:

  • Conduct pull-down assays with tagged yqfD to identify interaction partners

  • Perform bacterial two-hybrid or split-reporter assays to confirm direct interactions

  • Use crosslinking mass spectrometry to identify proximally located proteins in vivo

Microscopy Studies:

  • Create fluorescent protein fusions to track yqfD localization during sporulation

  • Perform time-lapse microscopy to correlate yqfD localization with sporulation stages

  • Use super-resolution microscopy to determine precise subcellular distribution

Regulatory Network Analysis:

  • Perform ChIP-seq for σE and σG to identify direct binding sites

  • Create reporter constructs to measure transcriptional activity of key promoters in wild-type versus yqfD mutant backgrounds

  • Develop mathematical models of the regulatory network incorporating yqfD

How can advanced structural biology techniques be applied to determine the three-dimensional structure of yqfD and identify potential binding sites?

For comprehensive structural characterization of yqfD:

X-ray Crystallography Approach:

  • Express, purify, and concentrate yqfD to >10 mg/mL

  • Screen crystallization conditions using commercial kits

  • Optimize promising conditions for diffraction-quality crystals

  • Collect diffraction data at synchrotron radiation facilities

  • Solve structure using molecular replacement (based on UDP-glucose 4-epimerase homologs) or experimental phasing

NMR Spectroscopy Alternative:

  • Express isotope-labeled (13C, 15N) yqfD

  • Collect multi-dimensional NMR spectra

  • Assign backbone and side-chain resonances

  • Generate structural restraints and calculate structure ensemble

Cryo-Electron Microscopy:

  • Prepare vitrified samples of purified yqfD

  • Collect high-resolution image data

  • Perform single-particle reconstruction

  • Build and refine atomic model

Binding Site Identification:

  • Perform in silico binding site prediction based on structural homologs

  • Use software such as SiteMap, FTMap, or CASTp

  • Validate predictions through site-directed mutagenesis

  • Conduct thermal shift assays or isothermal titration calorimetry with potential ligands

How should researchers interpret conflicting data regarding yqfD function, particularly between computational predictions and experimental results?

When faced with contradictory data about yqfD function:

Systematic Approach to Resolving Conflicts:

  • Re-evaluate Computational Predictions:

    • Assess confidence scores of bioinformatic predictions

    • Compare results from multiple prediction tools

    • Consider evolutionary distance between yqfD and its closest characterized homologs

    • Examine conservation patterns of key residues

  • Critical Assessment of Experimental Data:

    • Check for technical artifacts or limitations in experimental approaches

    • Consider condition-specific effects that might explain discrepancies

    • Evaluate statistical robustness of experimental results

    • Verify specificity of observed phenotypes through complementation studies

  • Integration Strategies:

    • Develop multiple working hypotheses that could explain conflicting observations

    • Design experiments specifically to discriminate between alternative hypotheses

    • Consider potential moonlighting functions where yqfD might have multiple roles

    • Use systems biology approaches to place contradictory results in broader context

Decision Matrix for Resolving Conflicts:

Data Conflict ScenarioValidation ApproachInterpretation Strategy
High sequence similarity to UDP-glucose 4-epimerase but no detectable epimerase activityTest alternative substrates; check for cofactor requirements; examine post-translational modificationsConsider substrate specificity differences; evaluate potential regulatory mechanisms; assess need for protein partners
Bioinformatics predicts cytoplasmic localization but experiments show membrane associationUse multiple localization prediction tools; employ different fractionation methods; create GFP fusionsConsider condition-dependent localization; examine potential lipid binding motifs; evaluate oligomerization state
Predicted regulatory network connections not confirmed experimentallyTest under various growth conditions; use alternative reporter systems; examine temporal dynamicsConsider indirect regulatory effects; evaluate threshold effects; examine redundant pathways

What are common technical challenges when working with recombinant yqfD protein and how can they be addressed?

Challenge 1: Poor Expression Levels

  • Solution: Optimize codon usage, test different promoters, adjust temperature and induction conditions, and consider the optimized DegSU QS system which has shown 118.3% increased promoter strength through the PaprE E742 promoter

  • Approach: Test expression in different host strains, including specialized B. subtilis strains with knockouts of competitive target genes (sacB, amyE) and operons (pgs, srfA)

Challenge 2: Protein Insolubility/Aggregation

  • Solution: Adjust buffer conditions (pH, ionic strength, additives), co-express with chaperones, use solubility tags, or try in vitro refolding

  • Approach: Screen multiple buffer compositions using dynamic light scattering to monitor aggregation

Challenge 3: Protein Instability

  • Solution: Add stabilizing agents, optimize storage conditions, use fusion partners that enhance stability

  • Approach: Analyze instability index (II) through bioinformatics tools; proteins with II below 40 are generally considered stable

Challenge 4: Lack of Activity

  • Solution: Ensure proper folding, verify presence of required cofactors, check for inhibitors in the buffer, test with different substrates

  • Approach: Perform circular dichroism to confirm secondary structure; test enzymatic activity under various conditions

Challenge 5: Difficulties in Structural Studies

  • Solution: Optimize construct design by removing flexible regions, use surface entropy reduction, try orthologues from related species

  • Approach: Create a panel of constructs with different truncations based on secondary structure predictions

How can researchers address contradictory phenotypes observed in yqfD mutants across different strain backgrounds?

When dealing with strain-dependent phenotypic variations in yqfD mutants:

Systematic Analysis Framework:

  • Strain Genome Comparison:

    • Perform whole-genome sequencing of strains showing different phenotypes

    • Identify single nucleotide polymorphisms (SNPs) and structural variations

    • Focus on genes known to interact with sporulation pathways

    • Create a comprehensive table of genomic differences

  • Epistasis Analysis:

    • Create double mutants of yqfD with genes suspected to cause background-dependent effects

    • Examine phenotypic outcomes to establish genetic relationships

    • Construct genetic interaction networks

  • Environmental Factor Examination:

    • Test identical mutants under precisely controlled conditions

    • Systematically vary media components, temperature, pH, and other environmental factors

    • Document condition-specific phenotypic differences

  • Cross-Complementation Studies:

    • Express yqfD from one strain background in the yqfD mutant of another background

    • Test if phenotypic differences persist after complementation

    • Analyze differences in expression levels and protein modifications

Resolution Table: Addressing Strain-Dependent Phenotypic Variations

ObservationPotential CauseInvestigation MethodResolution Approach
Phenotypic severity differs between lab strainsGenetic suppressors or enhancersWhole-genome comparison and targeted sequencingCreate isogenic strains through precise genetic manipulation
Some strains show no σG activity reduction despite yqfD mutationRedundant pathwaysTranscriptome analysis of different strainsIdentify and characterize compensatory mechanisms
Growth condition-dependent phenotypesMetabolic differences between strainsMetabolomic profiling under varied conditionsStandardize testing conditions and document strain-specific requirements
Variability in sporulation timingDifferences in regulatory network dynamicsTime-course analysis of key sporulation markersDevelop strain-specific temporal models of the sporulation process

What emerging technologies could advance our understanding of yqfD function and its role in B. subtilis biology?

Several cutting-edge technologies hold promise for elucidating yqfD function:

CRISPR-Cas9 Functional Genomics:

  • High-throughput CRISPR screening to identify genetic interactions with yqfD

  • CRISPRi for tunable repression to study dosage effects

  • Base editing for introducing specific point mutations to analyze structure-function relationships

Advanced Imaging Techniques:

  • Single-molecule tracking of labeled yqfD to monitor dynamics in living cells

  • Correlative light and electron microscopy to connect protein localization with ultrastructural features

  • Expansion microscopy for improved resolution of protein distribution within spores

Systems Biology Approaches:

  • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics) to place yqfD in biological context

  • Flux balance analysis to model metabolic impacts of yqfD mutation

  • Machine learning for pattern recognition in complex datasets

Structural Biology Innovations:

  • AlphaFold2 and other AI-driven protein structure prediction tools to generate high-confidence structural models

  • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics and interactions

  • Microcrystal electron diffraction for structural determination from nanocrystals

Synthetic Biology Tools:

  • Optogenetic control of yqfD expression for precise temporal studies

  • Biosensors to monitor yqfD activity in real-time

  • Minimal genome approaches to assess essentiality in defined genetic backgrounds

How might comparative genomics and evolutionary analyses of yqfD orthologs across different bacterial species inform its functional characterization?

Comparative genomics approaches provide valuable context for understanding yqfD function:

Evolutionary Conservation Analysis:

  • Identify yqfD orthologs across bacterial species, particularly within Firmicutes

  • Perform multiple sequence alignments to identify conserved residues

  • Calculate selection pressures (dN/dS ratios) to identify functionally important regions

  • Map conservation patterns onto predicted structural models

Genomic Context Examination:

  • Analyze gene neighborhoods surrounding yqfD orthologs

  • Identify conserved operonic structures that might suggest functional relationships

  • Look for co-evolution patterns with other genes

  • Construct presence/absence patterns across species with different physiologies

Functional Divergence Assessment:

  • Classify orthologs based on sequence similarity and domain architecture

  • Express and characterize orthologs from diverse species

  • Perform complementation studies in B. subtilis yqfD mutants

  • Identify correlations between sequence variations and functional differences

Evolutionary Trajectory Reconstruction:

  • Build phylogenetic trees of yqfD orthologs

  • Map functional variations onto the evolutionary tree

  • Identify ancestral states and evolutionary innovations

  • Correlate with the evolution of sporulation processes across species

What potential biotechnological applications might emerge from a deeper understanding of yqfD function in B. subtilis?

Understanding yqfD function could lead to several biotechnological applications:

Improved Recombinant Protein Expression:

  • If yqfD influences cell wall properties or secretion, its optimization could enhance protein secretion systems

  • Integration with existing optimized expression systems like the DegSU QS system could further improve yields

  • Development of strain-specific expression strategies based on yqfD function

Sporulation Control:

  • Engineering spore properties for improved stability in probiotics or biocontrol agents

  • Development of controlled germination systems for timed release applications

  • Creating spores with altered surface properties for biocatalysis or biomaterial applications

Metabolic Engineering:

  • If yqfD functions as a UDP-glucose 4-epimerase, it could be leveraged for engineering glycosylation pathways

  • Optimization of cell wall polymer production for biomaterials

  • Development of novel biosynthetic pathways for specialized carbohydrates

Synthetic Biology Applications:

  • Integration of yqfD into synthetic genetic circuits for conditional gene expression

  • Development of biosensors based on yqfD regulatory mechanisms

  • Creation of orthogonal systems for controlled cellular differentiation

Antimicrobial Development:

  • If yqfD proves essential for sporulation or cell wall integrity, it could represent a novel target for antibiotics

  • Structure-based drug design targeting yqfD for species-specific inhibition

  • Development of anti-biofilm strategies based on sporulation interference

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.