Recombinant Bacillus subtilis Uncharacterized protein yqfX (yqfX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yqfX; BSU25080; Uncharacterized protein YqfX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqfX
Target Protein Sequence
MKVANDYEKRDNNSYYVDHGSEGTNITRDNDGFFEETAAEIAEPYRAADRSNDQDNDRSG GNVNEGRGIGYIALALSIISLFVLPVLLGAAGIIVGYIARRRGAQGLGAWAMGIGVVSLV LGIFIIPFF
Uniprot No.

Target Background

Database Links

KEGG: bsu:BSU25080

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant B. subtilis proteins?

Various expression systems can be used for recombinant B. subtilis proteins, each with distinct advantages:

Table 1: Comparison of Expression Systems for Recombinant Protein Production

Expression SystemAdvantagesDisadvantagesSuitability for yqfX
E. coliHigh yield, well-established protocols, cost-effectivePotential issues with proper folding of Gram-positive proteinsCommonly used for initial characterization
B. subtilisNative environment, proper folding, secretion capability, GRAS statusSecretes multiple proteases that can degrade target proteinsIdeal for functional studies
Yeast (S. cerevisiae, K. phaffii)Post-translational modifications, high yield for secreted proteinsMay introduce non-native glycosylationSuitable for structural studies
Mammalian cell linesComplex folding and modificationsExpensive, lower yieldsFor specific interaction studies

For uncharacterized proteins like yqfX, the optimal approach often involves parallel expression in both E. coli and B. subtilis systems. E. coli provides sufficient material for initial characterization, while expression in native B. subtilis allows for functional studies in the proper cellular context .

What challenges are specific to working with uncharacterized proteins like yqfX?

Working with uncharacterized proteins presents several methodological challenges:

  • Function prediction limitations: Without characterized homologs, computational prediction may yield limited insights

  • Expression optimization: Determining optimal conditions without functional assays can be difficult

  • Protein solubility: Many uncharacterized proteins have hydrophobic regions that complicate purification

  • Functional assays: Developing appropriate assays to test hypothesized functions requires creative experimental design

  • Structural analysis: Without functional data, interpreting structural information becomes more challenging

For yqfX specifically, its membrane-associated nature (based on sequence analysis) suggests potential solubility challenges when expressing the recombinant protein. The transmembrane prediction indicates hydrophobic regions that may require detergent-based purification strategies .

What experimental approaches would be most effective for characterizing the function of yqfX?

Given the transcriptomic evidence linking yqfX to sporulation and germination , a multi-faceted approach would be most effective:

Table 2: Experimental Approaches for Functional Characterization of yqfX

ApproachMethodologyExpected OutcomeTechnical Considerations
Gene knockoutCRISPR-Cas9 or homologous recombination in B. subtilisPhenotypic changes in sporulation/germination efficiencyMay require conditional knockout if essential
Transcriptional analysisRNA-Seq comparing wild-type and knockout strains during sporulationCo-regulated genes and affected pathwaysRequires careful timing of sample collection
Protein localizationFluorescent protein fusion or immunofluorescenceSubcellular localization during different growth phasesMust verify fusion protein functionality
Protein-protein interactionPull-down assays, bacterial two-hybrid, or proximity labelingIdentification of interacting partnersMembrane protein interactions require specialized approaches
Complementation studiesExpression in related Bacillus species with different sporulation characteristicsConservation of function across speciesRequires vector systems compatible with multiple Bacillus species

The experimental design should focus on the sporulation-germination cycle, given the transcriptomic evidence. Time-course experiments are particularly important, as yqfX expression peaks at specific points during the sporulation process .

How can transcriptomic data be leveraged to elucidate the regulatory network controlling yqfX expression?

Transcriptomic analysis has already provided valuable insights into yqfX expression patterns. To further elucidate its regulatory network:

  • Promoter analysis: Examining the yqfX promoter region can identify binding sites for known sporulation-specific sigma factors (σE, σF, σG, σK)

  • Co-expression clustering: K-means clustering of transcriptomic data can identify genes with expression patterns similar to yqfX

  • Time-course differential expression: Careful analysis of expression changes during the transition from exponential growth to sporulation can reveal regulatory triggers

From existing data, we know yqfX shows expression patterns similar to spore coat proteins, suggesting regulation by late sporulation sigma factors (likely σG or σK) .

What experimental designs are appropriate for investigating potential horizontal gene transfer of yqfX between Bacillus subspecies?

Horizontal gene transfer (HGT) analysis requires careful experimental design and bioinformatic approaches:

  • Comparative genomics:

    • Compare yqfX sequences across multiple Bacillus species and subspecies

    • Analyze GC content, codon usage, and phylogenetic incongruence

  • Experimental HGT assessment:

    • Design experiments similar to those described in search result , where:

      • Transfer between subspecies occurs at a constant rate

      • Sequence identity at integration points is higher (93.6% vs. background 92.4%)

      • Integration shows bias toward higher sequence identity regions

  • Laboratory evolution approach:

    • Monitor changes in yqfX sequence and expression in mixed Bacillus cultures over extended cultivation periods

    • Use whole genome sequencing to detect recombination events

  • Detection of selection signatures:

    • Calculate dN/dS ratios to determine if yqfX is under purifying or positive selection

    • Compare these patterns across different Bacillus lineages

The research by indicates that homologous recombination does not occur stochastically and is biased toward higher sequence identity regions. This suggests that yqfX transfer between subspecies would depend on the conservation level of its sequence.

How should researchers design experiments to investigate the role of yqfX in sporulation using quasi-experimental approaches?

Given the ethical and practical constraints of certain experimental designs, quasi-experimental approaches can provide valuable insights:

Quasi-experimental designs are particularly valuable when complete randomization is not feasible, such as when studying gene function in complex microbial communities or when knockout construction is challenging .

How should researchers analyze contradictory data regarding yqfX function?

When faced with contradictory data about yqfX function:

  • Systematically evaluate experimental conditions:

    • Growth media composition affects gene expression in B. subtilis

    • Growth phase critically influences sporulation gene expression

    • Temperature affects protein folding and activity

  • Consider strain differences:

    • Different B. subtilis strains show variations in gene expression and regulation

    • The 17 sequenced B. subtilis strains may show differences in yqfX function

  • Perform meta-analysis:

    • Integrate data from multiple studies using standardized effect sizes

    • Weight evidence based on methodological quality and sample size

  • Design decisive experiments:

    • Identify key discrepancies between conflicting results

    • Design experiments specifically targeting these discrepancies

    • Include appropriate controls and validation steps

  • Examine gene context and operon structure:

    • Analyze if yqfX is part of an operon with other characterized genes

    • Determine if polar effects might influence phenotypic observations in knockout studies

Similar approaches have been used to resolve functional uncertainties for other B. subtilis proteins like Hfq, which despite structural similarities with other Hfq proteins, appears to have a specialized function in stationary phase physiology rather than the expected role in post-transcriptional regulation .

What bioinformatic approaches are most valuable for predicting potential functions of yqfX?

Multiple bioinformatic approaches should be integrated to predict yqfX function:

Table 3: Bioinformatic Approaches for Function Prediction

ApproachToolsApplication to yqfXLimitations
Sequence homologyBLAST, HHpredIdentify distant homologs with known functionsLimited by database annotations
Structural predictionAlphaFold, I-TASSERPredict 3D structure to infer functionAccuracy varies for membrane proteins
Protein domain analysisInterProScan, PFAMIdentify conserved domainsMay miss novel domains
Genomic contextSTRING, GeConTAnalyze neighboring genes and operonsContext may vary across species
Expression correlationExpressDB, COLOMBOSFind co-expressed genesRequires extensive expression data
Phylogenetic profilingPhyloProIdentify proteins with similar evolutionary patternsDepends on quality of genome annotations

For yqfX specifically, combining transcriptomic data showing upregulation during sporulation with structural predictions and genomic context would provide the most comprehensive function prediction.

How can researchers effectively use data tables in Excel for analyzing yqfX expression data?

When analyzing yqfX expression data in Excel:

These approaches allow for robust analysis of complex expression data and facilitate the identification of conditions that significantly affect yqfX expression .

What emerging techniques might advance our understanding of yqfX function?

Several emerging techniques show promise for uncharacterized proteins like yqfX:

  • Single-cell transcriptomics:

    • Reveal cell-to-cell variability in yqfX expression during sporulation

    • Identify subpopulations with distinct expression patterns

  • CRISPR interference (CRISPRi):

    • Allow tunable repression of yqfX expression

    • Study phenotypic effects of partial loss of function

  • Proximity labeling proteomics (BioID or APEX):

    • Identify proteins in close proximity to yqfX

    • Map the protein interaction network in living cells

  • Cryo-electron tomography:

    • Visualize yqfX in its native cellular context

    • Determine its location relative to sporulation structures

  • Synthetic biology approaches:

    • Engineer synthetic circuits to test hypothesized functions

    • Create protein variants with modified domains to test structure-function relationships

The application of these techniques to yqfX would significantly advance our understanding of its role in B. subtilis physiology and potentially reveal new insights into bacterial sporulation mechanisms.

How might understanding yqfX function contribute to broader knowledge of bacterial sporulation?

Understanding yqfX function could have several broader impacts:

  • Complete the sporulation gene regulatory network:

    • Fill gaps in our understanding of the complex cascade of gene activation

    • Identify new regulatory connections between known sporulation factors

  • Evolutionary insights:

    • Compare yqfX function across different sporulating bacteria

    • Understand the conservation and divergence of sporulation mechanisms

  • Potential biotechnological applications:

    • Improve spore-based probiotics by modifying sporulation efficiency

    • Enhance the stress resistance of industrial Bacillus strains

  • Fundamental biological questions:

    • Contribute to understanding how bacteria transition between different physiological states

    • Provide insights into bacterial cell differentiation mechanisms

The high conservation of yqfX across B. subtilis strains suggests an important function that has been maintained through evolutionary pressure, similar to the conservation pattern observed with the Hfq protein across 17 B. subtilis strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.