Recombinant Bacillus subtilis Uncharacterized protein yqgC (yqgC)

Shipped with Ice Packs
In Stock

Description

Protein Classification and Conservation

The yqgC protein belongs to a family of uncharacterized proteins with a domain of unknown function (DUF456) . In databases, it is classified under COG2839, a cluster of orthologous groups found in over 1,000 sequenced bacterial genomes, including organisms such as Deinococci, Mycobacteroides abscessus, and Salmonella enterica . This wide distribution suggests an evolutionarily conserved and potentially significant function across diverse bacterial species.

While homologs of yqgC are widely distributed, the genomic organization where yqgC is co-transcribed with sodA (as found in the yqgC-sodA operon) is predominantly observed in the Bacillus genus and occasionally in other members of the Bacillaceae family . This specific gene neighborhood pattern may indicate specialized functions in these bacterial groups.

Transcriptional Organization

The yqgC gene is transcribed together with the downstream sodA gene (encoding manganese-dependent superoxide dismutase) as part of a complex, two-gene operon designated yqgC-sodA (YS) . This operon features multiple transcriptional start sites, with initiation occurring both upstream of yqgC and at two different promoters within the 178 bp yqgC-sodA intergenic region . The upstream promoter is associated with the production of a 128 nt long 5'-untranslated region designated ncr2103 or S936 .

Functional Role in Manganese Homeostasis

Recent research has revealed that the yqgC-sodA operon plays a crucial role in bacterial manganese (Mn) homeostasis. While deletion of either gene individually causes minimal phenotypic effects, deletion of the entire operon (yqgC-sodA or YS) results in pronounced hypersensitivity to manganese . This hypersensitivity is attributed to reduced expression of two key Mn efflux proteins, MneP and MneS, leading to abnormal accumulation of manganese within bacterial cells .

The relationship between yqgC, SodA, and manganese homeostasis represents a novel regulatory mechanism in Bacillus subtilis. MnSOD (encoded by sodA) is the most abundant Mn-containing protein in the bacterial cell and is essential for oxidative stress resistance, while yqgC appears to function as a co-factor in this manganese regulation system .

Protection of Magnesium-Dependent Enzymes

One of the most significant functions of the yqgC-sodA operon appears to be the protection of magnesium-dependent enzymes by supporting manganese efflux . In mutants with the entire operon deleted (YS mutants), researchers observed:

  1. Accumulation of high levels of manganese

  2. Increased reactive radical species (RRS)

  3. Broad metabolic alterations attributed to inhibition of Mg-dependent enzymes

These effects were particularly pronounced on magnesium-dependent enzymes of the menaquinone, siderophore, and tryptophan (MST) family that utilize chorismate as a substrate . This demonstrates that yqgC, in conjunction with SodA, plays a protective role in preventing manganese-induced toxicity and ensuring proper functioning of critical metabolic pathways.

Manganese Sensitivity in Mutant Strains

A key experimental finding that elucidated the function of yqgC came from comparative studies of various Bacillus subtilis mutant strains and their sensitivity to manganese stress. The following table summarizes intracellular manganese concentrations (ng Mn/mg protein) in different strains under normal conditions (LB) and after manganese shock:

StrainsLBLB+Mn shock
WT5±0.632±13
yqgC3±125±8.4
sodA4±1.632±19
S9365±3.232±15
S936-sodA6±0.3359±4
YS5±1.9471±72
PS6±1339±117
YSPS4±0.5218±18
YS meeY-Trp71Arg5±0.3514±90
YS meeF-Ile206Thr5±0.5274±135
YS meeF-Phe225Val4±0.754±13.5
YS mTn yazB4±0.47217±30

This data clearly demonstrates that while individual deletions of yqgC or sodA have minimal effects on manganese accumulation, deletion of the entire operon (YS strain) results in a dramatic increase in intracellular manganese levels following manganese shock (471±72 ng Mn/mg protein compared to 32±13 in wild type) . This provides strong evidence for the synergistic function of these two proteins in manganese homeostasis.

Distinctive Mechanisms of Manganese Toxicity

An intriguing finding from recent research is that while both the yqgC-sodA deletion strain (YS) and an efflux-deficient mneP mneS double mutant accumulate manganese and show similar metabolic perturbations, they display distinct phenotypic differences . Several mutations that suppressed manganese intoxication in the mneP mneS efflux mutant did not benefit the YS mutant .

Furthermore, manganese intoxication in the YS mutant, but not the mneP mneS strain, could be alleviated by expression of magnesium-dependent, chorismate-utilizing enzymes of the MST family . This suggests that despite their phenotypic similarities, the mechanisms underlying manganese sensitivity in these mutants are fundamentally different, highlighting the unique role of the yqgC-SodA system.

Research Applications

The recombinant yqgC protein serves several important research applications:

  1. Metal homeostasis studies: As a key component in manganese regulation, recombinant yqgC is valuable for investigating metal ion homeostasis mechanisms in bacteria

  2. Structural biology research: The protein's unique membrane-associated structure makes it an interesting subject for studies on bacterial membrane proteins

  3. Protein-protein interaction studies: Investigating interactions between yqgC and its functional partners, including SodA, MneP, and MneS

  4. Evolutionary biology: Comparative studies across different bacterial species to understand the conservation and functional diversity of this protein family

According to STRING database analysis, yqgC has predicted functional partnerships with several other proteins, including:

  • yqgB (factor involved in motility) with a high confidence score of 0.937

  • sodA (superoxide dismutase) with a confidence score of 0.534

  • yceF (putative stress adaptation transporter) with a confidence score of 0.548

Product Specs

Form
Lyophilized powder
Note: We typically ship the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs unless otherwise specified. If you require dry ice shipping, please contact us in advance. Additional fees will apply for dry ice shipping.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yqgC; BSU25030; Uncharacterized protein YqgC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqgC
Target Protein Sequence
MDMLYWLLIAAVFIIAFIGLVYPVIPSVVFIVAGFVLYGFLFSFSPYSYMFWLVEAVFAA VLFAADYVSNLLGVKRFGGSKAAIWGSTIGLLIGPFVIPVAGIILGPFIGAVCAELIVHQ KDLKSAFKIGLGSLIGFLTGVIAKGIIQLLMIGYFLWTVL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YqgC and what is its relationship to the yqgC-sodA (YS) operon?

YqgC is an integral membrane protein of unknown function in Bacillus subtilis that forms part of the yqgC-sodA (YS) complex operon. It is co-transcribed with sodA, which encodes a manganese-dependent superoxide dismutase (MnSOD) . The YS operon plays a critical role in manganese homeostasis, with transcription initiating upstream of yqgC and from two promoters within the 178 bp YS intergenic region . The intergenic promoter is associated with a 128 nt long 5'-untranslated region designated as ncr2103 or S936 . While individual deletions of yqgC or sodA do not produce significant phenotypes, deletion of the entire operon results in severe manganese hypersensitivity .

What expression systems are most effective for recombinant YqgC production?

Recombinant YqgC can be produced using various heterologous expression systems, each with specific advantages for different research applications. Cell-free expression systems enable rapid production with minimal host interference, making them particularly useful for initial characterization studies. For higher yield purification, affinity tag-based systems facilitate efficient isolation of the protein. When working with membrane proteins like YqgC, specialized E. coli strains such as SHuffle are recommended to promote proper disulfide bond formation, which may be critical for maintaining the protein's native conformation. For complementation studies, expression of yqgC from an ectopic site (such as the amyE locus) using inducible promoters like Phyperspank with IPTG as inducer has been demonstrated to partially rescue manganese sensitivity phenotypes in YS deletion strains .

How does deletion of the yqgC-sodA operon affect cellular physiology?

Deletion of the complete yqgC-sodA operon produces distinct phenotypic changes that illuminate the functional importance of these genes:

PhenotypeYS Operon DeletionIndividual yqgC or sodA DeletionmneP mneS Double Mutant
Mn sensitivityHypersensitiveNormal resistanceSensitive
Mn accumulationHigh levelsNormal levelsHigh levels
Reactive radical speciesIncreasedNormal levelsIncreased
Mg-dependent enzyme functionInhibitedNormalInhibited
Expression of Mn efflux proteins (MneP, MneS)ReducedNormalNot applicable
Metabolome perturbationBroad alterationsMinimalSimilar but distinct pattern

The YS strain exhibits pronounced hypersensitivity to manganese compared to wild-type strains, accumulating high levels of Mn intracellularly . This accumulation coincides with increased reactive radical species and broad metabolic alterations, particularly affecting magnesium-dependent enzymes including key chorismate-utilizing MST (menaquinone, siderophore, and tryptophan) family enzymes . Notably, the YS deletion strain has reduced expression of manganese efflux proteins MneP and MneS, which explains the observed manganese sensitivity .

Can the manganese sensitivity phenotype of YS deletion be rescued?

The manganese sensitivity phenotype observed in YS deletion strains can be rescued through multiple genetic approaches, providing insights into functional relationships:

  • Partial complementation: Expression of either yqgC or sodA individually at the amyE locus using an IPTG-inducible Phyperspank promoter partially restores manganese resistance .

  • Complete complementation: Expression of either the S936-sodA region or the entire yqgC-S936-sodA operon completely abolishes manganese sensitivity .

  • Efflux protein overexpression: Induction of MneP from an IPTG-inducible promoter restores the ability of YS mutants to grow in media supplemented with 150 μM Mn .

  • Heterologous efflux proteins: Expression of MntE from Staphylococcus aureus (a homolog of B. subtilis MneS and MneP) also restores manganese resistance, while E. coli FieF does not rescue the phenotype despite its role in Zn, Fe, and Mn efflux in E. coli .

These complementation studies strongly support the hypothesis that manganese sensitivity in YS strains primarily results from deficiency in manganese efflux capacity .

What are the proposed functional homologs of YqgC in related bacteria?

Despite YqgC's uncharacterized status, insights into its potential function can be derived from homologs in related species:

OrganismProteinIdentity to YqgCProposed Role
Bacillus subtilisYqjH36% (to DinB)UV-induced mutagenesis, DNA repair
Escherichia coliDinBStructural homologTranslesion DNA polymerase

YqjH in B. subtilis is critical for UV resistance and mutagenesis, suggesting YqgC may participate in stress response pathways. Additionally, YqgC shares motifs with error-prone DNA polymerases of the UmuC/DinB family, hinting at potential roles in replication fidelity or damage tolerance. Alternative hypotheses suggest possible regulatory roles in translation or stress response, inferred from GTPase homologs like YjeQ.

What methodologies are optimal for studying membrane protein topology and integration of YqgC?

As an integral membrane protein, investigating YqgC's topology and membrane integration requires specialized approaches:

  • Membrane fraction isolation: Differential centrifugation followed by sucrose gradient fractionation can isolate membrane fractions containing YqgC. Western blotting with rabbit polyclonal antibodies against YqgC (which have demonstrated reactivity against E. coli O157:H7 and K12 strains) enables detection of the protein in different cellular compartments.

  • Membrane topology mapping: Cysteine scanning mutagenesis combined with membrane-impermeable sulfhydryl reagents can determine which regions of YqgC are exposed to either side of the membrane. PhoA or GFP fusion analysis at various positions can further validate topology predictions.

  • Structural domain analysis: Computational prediction algorithms suggest potential OB-fold or zinc knuckle domains (common in RNA-binding proteins), which warrant 3D structural analysis. X-ray crystallography or cryo-electron microscopy of purified YqgC may reveal structural features similar to those observed in YqgQ, another B. subtilis protein that primarily comprises a three-helical bundle .

  • Interactome analysis: Proximity-dependent labeling approaches (BioID or APEX2) fused to YqgC can identify proximal proteins within the membrane environment, potentially revealing functional partners beyond SodA.

How can mutational analysis elucidate the functional relationship between YqgC and manganese homeostasis?

Strategic mutational approaches can provide mechanistic insights into YqgC's role in manganese homeostasis:

  • Site-directed mutagenesis: Targeted mutation of conserved residues within YqgC, particularly those in predicted functional domains, followed by complementation analysis in YS deletion strains can identify critical amino acids for function.

  • Domain swap experiments: Given the partial complementation observed when expressing yqgC alone, constructing chimeric proteins containing domains from YqgC and known metal homeostasis proteins may reveal functional regions.

  • Suppressor mutation screening: Several mutations have been identified that suppress manganese intoxication in mneP mneS double mutants . Similar suppressor screens in YS deletion backgrounds may identify genetic interactions specific to YqgC function.

  • Conditional depletion systems: Rather than complete deletion, constructing strains with inducible expression of yqgC enables temporal control over protein levels, facilitating investigation of immediate versus long-term consequences of YqgC loss.

  • Promoter-reporter fusions: Constructing transcriptional fusions between mneP/mneS promoters and reporter genes (e.g., lacZ) in various yqgC mutant backgrounds can directly assess how YqgC influences expression of these efflux proteins.

What omics approaches can comprehensively characterize the metabolic impact of YqgC deficiency?

Multi-omics strategies can reveal the broader cellular impact of YqgC deficiency:

  • Comparative metabolomics: Targeted and untargeted metabolomics comparing wild-type, YS deletion, and individual gene deletion strains under varying manganese concentrations can identify specific metabolic pathways disrupted by YqgC loss. Previous studies have already identified broad metabolic alterations in YS strains, particularly affecting magnesium-dependent enzymes .

  • Proteomics analysis: Quantitative proteomics comparing membrane protein fractions between wild-type and YS deletion strains may reveal changes in protein abundance beyond the known reductions in MneP and MneS.

  • Transcriptome profiling: RNA-seq analysis comparing gene expression profiles of wild-type, YS deletion, and individual gene deletion strains can identify regulatory networks influenced by YqgC, potentially explaining the reduced expression of manganese efflux proteins.

  • Metalloproteomics: Using techniques like inductively coupled plasma mass spectrometry (ICP-MS) combined with protein fractionation can quantify metal distribution across the proteome, directly measuring how YqgC deficiency alters metal allocation.

  • Flux analysis: Metabolic flux analysis using isotope-labeled substrates can determine how alterations in enzyme activity due to metal misallocation affect carbon flow through central metabolic pathways.

How does YqgC influence manganese efflux and what is its relationship with known efflux proteins?

The functional relationship between YqgC and manganese efflux proteins requires mechanistic investigation:

  • Direct interaction studies: Co-immunoprecipitation or bacterial two-hybrid assays can assess whether YqgC physically interacts with MneP, MneS, or other components of metal efflux systems.

  • Metal transport assays: Measuring Mn2+ transport using radioactive 54Mn or fluorescent metal indicators in membrane vesicles prepared from wild-type, YS deletion, and complemented strains can quantify transport kinetics.

  • Gene expression analysis: Quantitative PCR or reporter fusions measuring mneP and mneS expression in response to manganese under various genetic backgrounds (wild-type, yqgC deletion, sodA deletion, and YS deletion) can establish the regulatory relationship between YqgC and these efflux genes.

  • Epistasis analysis: Constructing double and triple mutants combining YS deletions with other metal homeostasis genes and characterizing their phenotypes can establish genetic hierarchy.

  • Metal binding assessment: In vitro metal binding assays using purified YqgC can determine whether the protein directly binds manganese or other metals, potentially functioning as a metallochaperone.

What experimental approaches can differentiate between direct and indirect effects of YqgC on cellular processes?

Distinguishing direct from indirect effects requires temporal and mechanistic resolution:

  • Inducible expression systems: Rapid induction of YqgC in YS deletion backgrounds followed by time-course sampling can separate immediate from downstream effects.

  • Protein domain analysis: Construction of YqgC variants with mutations in specific functional domains can pinpoint which protein features are essential for different cellular processes.

  • Interactome dynamics: Temporal analysis of YqgC protein interactions following metal stress can identify primary interaction partners versus secondary responses.

  • Subcellular localization: Fluorescent protein fusions combined with live-cell imaging can track YqgC localization under different metal stress conditions, potentially revealing distinct localization patterns associated with different functions.

  • In vitro reconstitution: Purified components in defined biochemical assays can test direct enzymatic or structural roles of YqgC independent of cellular context.

What controls are essential when designing experiments investigating YqgC function?

Robust experimental design requires appropriate controls:

  • Genetic complementation controls: When analyzing YqgC mutant phenotypes, complementation with wild-type yqgC should restore function, while complementation with mutated versions should fail to rescue if the mutations affect critical residues.

  • Strain background considerations: B. subtilis strain backgrounds can significantly impact metal homeostasis phenotypes. Consistent strain backgrounds should be maintained across experiments, and key findings should be validated in multiple strains.

  • Metal specificity controls: Experiments testing manganese sensitivity should include other metals (zinc, iron, copper) to determine specificity of YqgC's role in manganese homeostasis versus general metal stress.

  • Expression level controls: When using recombinant YqgC, expression levels should be quantified and ideally matched to physiological levels to avoid artifacts from overexpression.

  • Domain-specific controls: When testing specific YqgC domains, isolated domains should be compared to full-length protein to account for potential interdomain interactions.

How should experimental conditions be optimized to study YqgC in relation to metal homeostasis?

Experimental conditions significantly impact metal homeostasis studies:

  • Metal concentration ranges: Dose-response experiments with manganese should span physiologically relevant concentrations (typically submicromolar to millimolar range). B. subtilis normally tolerates up to 1 mM Mn ion, but YS mutants show increased sensitivity .

  • Growth media considerations: Media composition dramatically affects metal bioavailability. Minimal media with defined metal content allows precise control, while rich media more closely approximates natural environments but introduces variability.

  • Growth phase standardization: Metal homeostasis mechanisms vary with growth phase. Synchronizing cultures and sampling at defined points in the growth curve ensures reproducibility.

  • Environmental stress conditions: Combined stressors (oxidative stress, pH shifts, nutrient limitation) can reveal condition-specific roles of YqgC that might not be apparent under standard conditions.

  • Metal speciation: Different manganese species (Mn2+, Mn3+, complexed forms) have distinct biological properties. Controlling and specifying metal speciation is critical for mechanistic studies.

What data analysis approaches are most appropriate for interpreting YqgC functional experiments?

Appropriate analytical frameworks enhance experimental interpretation:

  • Statistical considerations for phenotypic assays: Growth curve analysis should include both lag phase duration and exponential growth rate measurements with appropriate statistical tests for significance.

  • Normalization methods for omics data: When comparing metabolomic or proteomic profiles between strains, appropriate normalization strategies must account for global shifts in metabolism.

  • Network analysis for multi-omics integration: Integrating transcriptomic, proteomic, and metabolomic data through network analysis can identify coordinated responses beyond individual biomolecule changes.

  • Pathway enrichment analysis: Gene Ontology or KEGG pathway enrichment can identify biological processes most affected by YqgC deficiency, guiding further mechanistic studies.

  • Comparative genomics analysis: Examining genomic context and conservation of yqgC across bacterial species can provide evolutionary insights into functional importance and specialization.

What are the current consensus models for YqgC function?

Current evidence supports several potential models for YqgC function that are not mutually exclusive:

  • Metal homeostasis coordination: YqgC may function as a coordinator between manganese sensing and efflux systems, explaining why its deletion leads to reduced expression of MneP and MneS .

  • Membrane integrity maintenance: As an integral membrane protein, YqgC may maintain membrane properties critical for proper function of metal transporters.

  • Stress response modulation: Based on homology to DNA repair proteins like YqjH and DinB, YqgC may participate in stress response pathways that indirectly affect metal homeostasis.

  • SodA activity modulation: The functional linkage between YqgC and SodA suggests YqgC may regulate SodA activity or metal loading, with downstream effects on manganese pools.

What key questions remain unresolved in YqgC research?

Despite progress, several fundamental questions about YqgC remain unanswered:

  • Molecular mechanism: The biochemical activity of YqgC remains unknown. Does it have enzymatic activity, function as a transporter, or serve as a scaffold for protein complexes?

  • Structure-function relationship: How does YqgC's membrane topology relate to its function in manganese homeostasis?

  • Regulatory networks: How does YqgC influence the expression of manganese efflux proteins at the molecular level?

  • Evolutionary conservation: Is YqgC's role in manganese homeostasis conserved across bacterial species, or has it evolved specialized functions in different organisms?

  • Physiological relevance: Under what natural conditions does YqgC function become critical for bacterial survival and competitive fitness?

Addressing these questions will require interdisciplinary approaches combining genetics, biochemistry, structural biology, and systems biology to fully elucidate the function of this intriguing membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.