Recombinant Bacillus subtilis Uncharacterized protein yqgF (yqgF)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bacillus subtilis uncharacterized protein YqgF, commonly referred to as YqgF, is a protein that is found in the bacterium Bacillus subtilis . YqgF homologs are found in other bacteria, such as Escherichia coli, Helicobacter pylori, and Mycobacterium tuberculosis . The yqgF gene can be deleted in H. pylori and Acinetobacter baylyi ADP1, resulting in impaired growth in both knockout strains .

Structure

YqgF exists as a monomer in solution . The refined model of Deinococcus radiodurans YqgF (DrYqgF) contains one DrYqgF molecule in an asymmetric unit, with each monomer composed of five β-strands (β1 to β5) sandwiched by three α-helices (α1, α2, and α3) . The structure of DrYqgF closely resembles that of E. coli YqgF (EcYqgF), M. tuberculosis YqgF (MtYqgF), and Bacillus subtilis .

Function

M. tuberculosis YqgF (MtYqgF) can hydrolyze ATP and is a non-sequence-specific endonuclease capable of digesting various branched DNA/RNA substrates in the presence of ATP . YqgF homologs, such as HpDprB and MtRuvX in H. pylori and M. tuberculosis, respectively, have exhibited Holliday Junction (HJ) binding and resolution activity in vitro and can promote DNA repair in vivo via dimerization of the monomeric YqgF nuclease domain .

YqgF and YqgQ

YqgQ is another protein of unknown function from Bacillus subtilis . It is a member of the DUF910 family in the Pfam database . The protein molecule is mainly composed of a three-helical bundle . The putative function of YqgQ is inferred to be single-stranded nucleic acid binding based on sequence and structural homology . Structural comparison of YqgQ and PB-1 domain shows that α-helices 2 and 3 superpose exactly with the two helices in the PB-1 domain, which plays a distinct role in viral RNA polymerase and is essential for viral RNA transcription initiation . YqgQ may be indirectly involved in an RNA polymerization reaction during bacterial cell growth .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please indicate this during your order placement, and we will prioritize its use.
Synonyms
pbpA; yqgF; BSU25000; Penicillin-binding protein 2A; PBP-2B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-716
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqgF
Target Protein Sequence
MRRNKPKKQNHKEKKKSLPIRLNILFLAAFVIFTWIIVELGIKQIVQGDDYKNQANKQEQ SEVSSAVPRGKIYDRNFNAIVTNKALNAITYTRSKSTTQEQRLKIAKKLSDMIKVDTKKV TERDKKDYWILTRPKEAKKLISSKERQQVEDKKISDDDLYQLQLKRITDKQLNELTDKDM QILAIKRQMDSGYALTPQYIKNEDVSAKEMAVVSEHLDELPGVDVTSDWEREYPYKNLLR SVLGSVSSSNEGLPSNLLDHYLSLGYSRNDRVGKSYLEYQYESLLQGQKAKVENITDSKG NVTGTKTVSEGKAGKDLVLTIDIDLQKSVEKIIEKKLKAAKARPSTELLDRAFVVMMDPR NGEVLTMAGKQIKRENGAYKFDDYALGAMTSSYAMGSAVKGATVLTGLQTGAINLNTVFK DEPLYIGQDKRGKKSWQNLGPVGIQTALEKSSNVFMFKTAIAVGKGEYKPHQALPLDTSA FDTFRNYFSQFGLGVKTGIDLPNEMTGYKGTSRLSGFLLDFAIGQYDTYTPLELAQYVST IANGGYRMKPQLVKEVRDSNAKKGIGAVVDSVQPEVLNKVDMKSSYIEEVQAGFRRVATK GTAAGQLASASYKPAAKTGTAQSFYDGPDKSKTGTDTYNTTLVAYAPADNPEIAISVVVP WTYIDYNQRYSITNEIGREVMDKYFELKSKQDKEGTQQKNKDKIEENAENTTSSDN
Uniprot No.

Target Background

Function
This uncharacterized protein, yqgF, is involved in peptidoglycan synthesis associated with cell wall elongation, particularly following spore germination. It exhibits functional redundancy with PBP1 (ponA) and PBP4 (pbpD) during spore outgrowth and plays a redundant role with PbpH in maintaining the rod shape of the cell during vegetative growth and spore outgrowth.
Gene References Into Functions
  1. EzrA and GpsB exhibit partially distinct roles in PBP1 localization. EzrA primarily promotes PBP1 recruitment to division sites, while GpsB facilitates its removal from the cell pole after pole maturation completion. PMID: 18363795
Database Links
Protein Families
Transpeptidase family
Subcellular Location
Cell membrane. Forespore inner membrane; Single-pass membrane protein.

Q&A

What is the basic structure and molecular characteristics of Bacillus subtilis YqgF protein?

YqgF from Bacillus subtilis is an uncharacterized protein consisting of 716 amino acids with a molecular weight of approximately 82 kDa. The full-length protein structure contains both α-helices and β-sheets arranged in a globular quaternary structure . Based on structural analysis of homologous proteins, YqgF likely forms a homodimer in solution . The protein contains a conserved catalytic triad similar to RuvC family members, suggesting endonuclease activity. This catalytic triad typically consists of acidic residues (Asp and Glu) positioned at specific locations within the protein's tertiary structure .

For researchers beginning work with this protein, recombinant expression systems using E. coli with N-terminal His-tag fusions have been successfully employed to produce the protein in sufficient quantities for characterization studies .

How does YqgF differ from other uncharacterized "Y" proteins in Bacillus subtilis?

Bacillus subtilis contains several uncharacterized "Y" proteins that should not be confused with YqgF:

ProteinKey Distinguishing FeaturesKnown or Predicted Function
YqgFContains RuvC-like catalytic triadNovel endonuclease activity
YqfSSpore-specific proteinType IV AP-endonuclease
YqjGOxa1p homologMembrane protein biogenesis

YqgF stands apart from other "Y" proteins in B. subtilis through its structural similarity to the RuvC Holliday junction resolvase family. Unlike YqfS, which is specifically expressed during sporulation , YqgF lacks the temporal expression pattern associated with sporulation-specific proteins. Furthermore, YqgF does not share functional similarities with YqjG, which participates in SecYEG-dependent and -independent membrane protein insertion .

What are the optimal conditions for expressing and purifying recombinant B. subtilis YqgF?

For successful expression and purification of B. subtilis YqgF, researchers should consider the following methodological approach:

Expression System:

  • Host: E. coli expression system (e.g., BL21(DE3) strain)

  • Vector: pET series with N-terminal His-tag

  • Induction: 0.5-1.0 mM IPTG at mid-log phase (OD600 = 0.6-0.8)

  • Temperature: 18-22°C for 16-18 hours post-induction to minimize inclusion body formation

Purification Protocol:

  • Cell lysis in Tris/PBS-based buffer (pH 8.0) containing protease inhibitors

  • Clarification by centrifugation (20,000 × g, 30 min, 4°C)

  • Ni-NTA affinity chromatography with imidazole gradient elution

  • Size exclusion chromatography to ensure homogeneity

  • Final buffer: Tris/PBS-based buffer with 6% trehalose at pH 8.0

Storage Considerations:

  • Aliquot and store at -80°C for long-term storage

  • Add glycerol (final concentration 50%) for cryoprotection

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

What experimental approaches are most effective for characterizing YqgF's potential endonuclease activity?

To investigate YqgF's predicted endonuclease activity, researchers should employ the following methodological approaches:

In vitro Nuclease Assays:

  • Substrate preparation: Generate various DNA substrates including:

    • Linear double-stranded DNA

    • Supercoiled plasmid DNA

    • Synthetic Holliday junctions

    • AP site-containing DNA (for testing AP-endonuclease activity similar to YqfS )

  • Reaction conditions:

    • Buffer: 25 mM Tris-HCl pH 7.5, 50 mM NaCl, 5 mM MgCl2, 1 mM DTT

    • Test activity in presence of different divalent cations (Mg2+, Mn2+, Zn2+)

    • Include EDTA controls to assess metal-dependence

    • Incubate at 37°C for various time points (5-60 minutes)

  • Analysis methods:

    • Gel electrophoresis (native PAGE for structural changes, denaturing PAGE for cleavage products)

    • Fluorescence resonance energy transfer (FRET) for real-time monitoring

    • Mass spectrometry for precise cleavage site determination

DNA Binding Studies:

  • Electrophoretic mobility shift assays (EMSAs) to assess DNA binding affinity and specificity

  • Surface plasmon resonance (SPR) for kinetic binding parameters

  • Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

This comprehensive approach will help determine if YqgF, like its E. coli homolog, possesses the structural properties that permit it to bind and scan undamaged DNA and/or strongly interact with specific DNA structures .

How does the catalytic mechanism of B. subtilis YqgF compare to other RuvC-like endonucleases?

Based on structural analysis, B. subtilis YqgF contains a catalytic triad similar to RuvC family proteins, which typically consists of acidic residues (Asp and Glu) that coordinate divalent metal ions necessary for nuclease activity . The mechanistic comparison shows:

Catalytic Residue Comparison:

ProteinCatalytic ResiduesMetal CoordinationSubstrate Specificity
B. subtilis YqgFLikely D28, E116, D142/143 (based on M. tuberculosis homolog)Predicted trinuclear Zn centerUnder investigation
E. coli RuvCD7, E66, D138, D141Binuclear Mg2+ centerHolliday junctions
B. subtilis YqfSContains type IV AP-endonuclease domainTrinuclear Zn center resistant to EDTAAP sites, 3′-blocking groups

The catalytic mechanism likely involves:

  • Metal-ion assisted activation of a water molecule

  • Nucleophilic attack on the phosphodiester backbone

  • Generation of 3'-OH and 5'-phosphate termini

YqgF's resistance to EDTA inactivation in the presence of substrate DNA would suggest a tightly coordinated metal center similar to that seen in YqfS , though this requires experimental verification. The key mechanistic question remains whether YqgF processes Holliday junctions like RuvC or has evolved alternate substrate specificity, possibly for DNA repair pathways.

What is the evolutionary relationship between YqgF proteins across bacterial species?

YqgF is relatively well-conserved across bacterial species, with homologs identified in organisms including E. coli, M. tuberculosis, and D. radiodurans . Evolutionary analysis reveals:

Conservation Patterns:

  • The core RuvC-like fold is preserved across species

  • The catalytic triad residues show high conservation

  • The N-terminal and C-terminal regions display greater variability

Phylogenetic Relationships:

  • YqgF proteins from gram-positive bacteria (B. subtilis, M. tuberculosis) form a distinct clade

  • E. coli YqgF represents the proteobacterial lineage

  • D. radiodurans YqgF shows unique adaptations possibly related to extreme radiation resistance

Functional Divergence:
The E. coli YqgF crystal structure (PDB ID: 1NMN) provides a structural framework for comparative analysis, but functional adaptations across species remain to be fully characterized. Unlike the highly specialized YqfS in B. subtilis, which is specifically expressed during sporulation , YqgF appears to be more constitutively expressed across growth conditions, suggesting a more general role in cellular processes.

How can I design experiments to elucidate the biological role of YqgF in Bacillus subtilis?

To determine the biological function of YqgF in B. subtilis, a comprehensive experimental strategy combining genetics, biochemistry, and cell biology approaches is recommended:

Genetic Approaches:

  • Gene knockout studies:

    • Create precise in-frame deletion mutants using allelic replacement techniques

    • Phenotypically characterize ΔyqgF strains under various growth conditions

    • Assess sensitivity to DNA-damaging agents (UV, mitomycin C, H2O2, methyl methanesulfonate)

    • Test for synthetic lethality/sickness with mutations in known DNA repair pathways

  • Complementation analysis:

    • Express wild-type YqgF from an inducible promoter (e.g., Pspac)

    • Create catalytic mutants (D→N, E→Q) at predicted active site residues

    • Test cross-species complementation with E. coli, M. tuberculosis homologs

Protein Interaction Studies:

  • Pull-down assays:

    • Use His-tagged YqgF as bait

    • Identify interacting partners by mass spectrometry

    • Validate interactions by co-immunoprecipitation

  • Protein localization:

    • Create fluorescent protein fusions (ensuring functionality is maintained)

    • Monitor cellular localization during growth, stress, and DNA damage

    • Use time-lapse microscopy to track dynamic changes in localization

Genome-wide Approaches:

  • Transcriptomic analysis:

    • Compare RNA-seq profiles of wild-type and ΔyqgF strains

    • Identify differentially expressed genes and pathways

  • Synthetic genetic array:

    • Cross ΔyqgF with genome-wide knockouts

    • Identify synthetic lethal/sick interactions

    • Map genetic interaction networks

This multi-faceted approach will help place YqgF in the context of cellular pathways and identify its biological role in B. subtilis.

What are the key considerations for developing a promoter system to express YqgF for functional studies?

Based on promoter studies in B. subtilis, several considerations are critical for optimal YqgF expression:

Promoter Selection:
The choice of promoter significantly impacts expression levels. Consider:

  • Constitutive promoters:

    • P43: A commonly used strong constitutive promoter

    • Phybrid: Hybrid promoters created from −35 region of one promoter and −10 element of another can yield higher expression than either parental promoter

  • Inducible systems:

    • Pspac: IPTG-inducible, tight regulation

    • Pxyl: Xylose-inducible, graded response

Promoter Engineering Approach:
For optimal expression, consider using a promoter trap system similar to that described for B. licheniformis :

  • Construct a promoter trap vector containing:

    • Reporter gene (e.g., bgaB coding for heat-stable β-galactosidase)

    • Multiple cloning sites for promoter insertion

    • Resistance markers for selection

  • Screen library of promoter fragments for optimal expression:

    • Use X-Gal indicator plates for visual screening

    • Quantify expression levels using β-Gal activity assays

    • Select promoters with desired expression characteristics (strength, inducibility)

Expression Vector Design:
For the final expression construct, include:

  • Optimized ribosome binding site (RBS)

  • Appropriate spacing between promoter, RBS, and start codon

  • Affinity tag (N-terminal or C-terminal) for purification

  • Protease cleavage site for tag removal

Expression Optimization:

  • Use a signal sequence if secretion is desired

  • Consider codon optimization for B. subtilis

  • Engineer transcriptional terminators to prevent read-through

The experimental data from a promoter trap system showed that hybrid promoters can increase expression up to 3-fold compared to traditional promoters, making this approach particularly valuable for difficult-to-express proteins .

How do I interpret contradictory results between structural predictions and experimental data for YqgF?

When facing contradictions between computational predictions and experimental data for YqgF, consider the following systematic approach:

Common Sources of Discrepancy:

Type of DiscrepancyPossible CausesResolution Strategies
Structural predictions vs. crystal structureModeling limitations, protein flexibility, crystal packing artifactsValidate with solution studies (SAXS, NMR)
Predicted vs. observed catalytic activityPost-translational modifications, cofactor requirements, artificial conditionsSystematic biochemical assays varying conditions
Localization predictions vs. cellular observationsContext-dependent targeting, protein-protein interactionsFractionation studies, in vivo imaging with different tags

Methodological Approach:

  • Evaluate prediction confidence:

    • Check the quality scores of prediction algorithms

    • Assess the degree of conservation with template structures

    • Consider alternative models and their consistency

  • Review experimental conditions:

    • Ensure the protein is correctly folded (circular dichroism)

    • Verify activity in different buffer conditions

    • Test the effect of potential cofactors (metals, nucleic acids)

  • Reconcile with biological context:

    • Consider growth conditions and stress responses

    • Examine potential protein-protein interactions

    • Test for post-translational modifications

  • Integrate multiple data types:

    • Combine low-resolution and high-resolution structural data

    • Use functional genomics to inform biochemical results

    • Apply molecular dynamics simulations to bridge static structures with functional data

Case in point: The catalytic triad observed in M. tuberculosis YqgF (D28, E116, D142) might not be directly transferable to B. subtilis YqgF due to sequence variations. Experimental validation through site-directed mutagenesis and activity assays is essential to confirm the actual catalytic residues in B. subtilis YqgF.

What statistical approaches are most appropriate for analyzing YqgF activity assays?

For rigorous analysis of YqgF enzymatic activity data, appropriate statistical methods are crucial:

For Kinetic Assays:

  • Non-linear regression analysis:

    • Fit Michaelis-Menten equation for steady-state kinetics

    • Extract Km (substrate affinity) and kcat (catalytic rate) parameters

    • Use global fitting for inhibition studies

  • Statistical validation:

    • Calculate 95% confidence intervals for kinetic parameters

    • Perform residual analysis to verify model appropriateness

    • Use Akaike Information Criterion (AIC) to compare alternative kinetic models

For Comparative Experiments:

  • Hypothesis testing:

    • Use paired t-tests for before/after comparisons

    • Apply ANOVA with post-hoc tests (Tukey, Dunnett) for multiple conditions

    • Implement non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normal data

  • Experimental design considerations:

    • Power analysis to determine sample size requirements

    • Randomization and blinding where appropriate

    • Include positive and negative controls in each experiment

For Structure-Function Relationships:

  • Correlation analysis:

    • Pearson or Spearman correlation between structural parameters and activity

    • Multiple regression for complex relationships

    • Principal component analysis to identify key variables

  • Visualization techniques:

    • Activity heat maps mapped to protein structure

    • Scatter plots with regression lines for structure-activity relationships

    • Box plots for comparing mutant activities

Example Statistical Workflow:
For comparing wild-type YqgF activity with catalytic site mutants:

  • Perform activity assays in triplicate with appropriate controls

  • Test for normality using Shapiro-Wilk test

  • Apply one-way ANOVA followed by Dunnett's test (comparing mutants to wild-type)

  • Report means, standard deviations, and p-values

  • Consider effect sizes (Cohen's d) in addition to statistical significance

How can structural studies of YqgF inform the development of novel nuclease-based biotechnological tools?

YqgF's structural features and potential nuclease activity could inform the development of new biotechnological tools:

Structure-Guided Engineering:
Based on the RuvC-like fold and catalytic triad identified in YqgF , researchers could:

  • Engineer substrate specificity by modifying the DNA binding interface

  • Adjust metal coordination to alter catalytic properties

  • Create chimeric nucleases combining domains from different sources

  • Develop allosterically regulated variants for controlled activity

Potential Biotechnological Applications:

ApplicationYqgF Feature to ExploitRequired Modifications
Genome editingSequence-specific DNA cleavageFusion with DNA binding domains
Molecular diagnosticsNucleic acid recognitionReporter system integration
DNA damage researchAP site or structure-specific cleavageActivity optimization, fluorescent tagging
Synthetic biology circuitsControlled nuclease activityRegulatory domain addition

Development Pathway:

  • Solve high-resolution crystal structure of B. subtilis YqgF

  • Map DNA binding interface through mutational analysis

  • Determine precise cleavage mechanism and substrate specificity

  • Design and test engineered variants with altered properties

  • Optimize for stability and specificity in various applications

This approach mirrors successful engineering of other nucleases (e.g., restriction enzymes, Cas9) into biotechnological tools and could yield novel reagents for DNA manipulation and analysis.

What are the challenges and solutions in developing antibodies against YqgF for research applications?

Developing specific antibodies against B. subtilis YqgF presents several challenges that can be addressed with strategic approaches:

Key Challenges:

  • Antigenicity issues:

    • YqgF may contain regions with low immunogenicity

    • Potential cross-reactivity with other bacterial proteins

    • Conformational epitopes may be lost in denatured samples

  • Production considerations:

    • Obtaining sufficient quantities of properly folded protein

    • Maintaining stability during immunization protocols

    • Ensuring consistent antigen preparation

Strategic Solutions:

1. Antigen Design Options:

Antigen TypeAdvantagesLimitationsRecommended Use
Full-length recombinant YqgFComplete epitope representationSolubility/folding issuesWestern blot, IP
Synthetic peptides from unique regionsHigh specificity, defined epitopesLimited to linear epitopesParalog discrimination
Domain-specific fragmentsBetter solubility, focused responseIncomplete epitope coverageDomain-specific detection

2. Antibody Production Approaches:

  • Polyclonal antibodies: Generate using purified His-tagged YqgF

  • Monoclonal antibodies: Screen hybridomas for specificity using both wild-type and ΔyqgF lysates

  • Recombinant antibodies: Develop using phage display against specific YqgF epitopes

3. Validation Methods:

  • Western blot analysis of wild-type vs. ΔyqgF strains

  • Immunoprecipitation followed by mass spectrometry

  • Immunofluorescence microscopy with appropriate controls

  • Pre-absorption with purified antigen to confirm specificity

4. Cross-reactivity Management:

  • Pre-adsorb antibodies against lysates of ΔyqgF B. subtilis

  • Perform epitope mapping to identify unique regions

  • Test against related proteins (e.g., E. coli YqgF) to assess specificity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.