Recombinant Bacillus subtilis Uncharacterized protein yqhP (yqhP)

Shipped with Ice Packs
In Stock

Description

Introduction

The protein yqhP is an uncharacterized protein from Bacillus subtilis . Determining the characteristics of this protein can lead to a better understanding of its function within Bacillus subtilis.

Functional Inference

Based on structural comparisons, YqgQ shows similarities to the PB-1 domain found in viral RNA polymerase, which is essential for viral RNA transcription initiation . Sequence comparisons reveal homology to open reading frame 1 (ORF1) proteins, which interact with nucleic acids through positively charged arginine residues . YqgQ contains positively charged residues Arg50 and Lys57 in helix 3, with a distance of approximately 8.4 Å between their side-chain N atoms, comparable to the distance between consecutive phosphate groups in nucleic acids . This further suggests a potential role for YqgQ in binding to single-stranded nucleic acids .

Recombinant Expression in Bacillus subtilis

Recombinant Bacillus subtilis can express proteins with a variety of applications .

  • Recombinant Bacillus subtilis endospores have been utilized for vaccination against diseases like tetanus and anthrax .

  • Bacillus subtilis strains have been engineered to express proteins like glutathione-S-transferase (GST) fused to a carboxy-terminal domain of C. perfringens Cpa 247-370 .

  • These recombinant strains can express the target protein in vegetative cells or on the spore surface, or a combination of both .

  • Bacillus subtilis is also used for the production of metabolites, for example, pyrazinones and dihydropyrazinones .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yqhP; BSU24500; Uncharacterized protein YqhP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Bacillus subtilis (strain 168)
Target Names
yqhP
Target Protein Sequence
MNHRVQPIIAVLIALGAFGFLYVLVTNPGEMAKMAVTVIVAGIIIYFIVKYVMNRNAGSE GAAFKKAAKQSRRRMKEQKAKHRAGHKGRVSHLRSVPSASKPKPMILKKKSQTQLTVIEG KKNKKKNRALF
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is currently known about the YqhP protein in Bacillus subtilis?

YqhP is an uncharacterized protein from B. subtilis with limited functional information. Based on structural comparisons with other proteins, it may have similarities to proteins involved in nucleic acid interactions. Similar uncharacterized proteins, like YqgQ, show structural homology to the PB-1 domain found in viral RNA polymerase . Much like other uncharacterized B. subtilis proteins such as YloU and YqhY, YqhP may play an important role in bacterial physiology that has yet to be discovered .

How does YqhP compare with other uncharacterized proteins in B. subtilis?

YqhP belongs to a substantial group of uncharacterized proteins in B. subtilis. Research on similar proteins provides methodological frameworks:

Uncharacterized ProteinKey FindingsResearch Methods UsedReference
YqgQThree-helical bundle structure; potential single-stranded nucleic acid binding functionX-ray crystallography; SAD method; sequence homology analysis
YloU/YqhYMembers of Asp23 family; YqhY appears to control acetyl-CoA carboxylase activityGene deletion; suppressor mutation analysis; whole genome sequencing; fluorescence microscopy
YlxR (now RnpM)RNA-binding protein that modulates RNase P activityRNA binding assays; chemical cross-linking; in silico docking analysis; site-directed mutagenesis

To characterize YqhP, employ multiple complementary approaches rather than relying on a single technique. Begin with structural analysis and sequence comparisons, followed by functional assays based on preliminary predictions .

Why is studying uncharacterized proteins like YqhP important for bacterial research?

Characterizing proteins like YqhP is critical for several reasons:

  • Completing the functional annotation of model organisms: Even in well-studied B. subtilis, about 20% of proteins have unknown functions .

  • Discovering novel biological mechanisms: Many uncharacterized proteins reveal unexpected cellular processes when studied (as seen with YqhY's role in lipid metabolism) .

  • Identifying new targets for biotechnological applications: B. subtilis is widely used in industrial biotechnology .

  • Understanding bacterial adaptation: Uncharacterized proteins may play key roles in stress responses or environmental adaptation .

Research methodology should focus on both individual protein characterization and systems-level approaches to understand contextual function.

How should I design experiments to express and purify recombinant YqhP for functional studies?

Based on successful approaches with other B. subtilis proteins, implement the following methodology:

  • Expression system selection:

    • For cytoplasmic expression: Use strong promoters like the B. subtilis rrnO promoter with the sspA ribosome binding site .

    • For spore surface display: Create fusion proteins with spore coat proteins such as CotB .

  • Vector construction protocol:

    • Clone the yqhP gene without its stop codon if creating C-terminal fusions

    • For chromosomal integration, use vectors with amyE flanking sequences like pDL243

    • Select appropriate antibiotic resistance markers (chloramphenicol, kanamycin, or spectinomycin)

  • Transformation and verification:

    • Transform B. subtilis using SP medium supplemented with appropriate antibiotics

    • Verify recombinants through PCR and sequencing

    • Confirm protein expression via Western blotting or fluorescence microscopy if using tagged constructs

  • Purification strategy:

    • For cytoplasmic expression, use affinity tags like His-tag or GST-tag

    • For spore-displayed proteins, isolate spores and extract coat proteins using SDS-DTT buffer systems

What techniques are most effective for determining the function of uncharacterized proteins like YqhP?

Implement a multi-faceted approach combining:

  • Structural analysis:

    • X-ray crystallography or NMR to determine 3D structure

    • Compare with known structures using programs like DALI or PDBeFold

    • Look for structural motifs associated with specific functions

  • Genetic approaches:

    • Gene deletion using PCR products with antibiotic resistance cassettes

    • Monitor for suppressor mutations that may reveal functional pathways

    • Construct conditional mutants if deletion is lethal

  • Interaction studies:

    • Identify binding partners through pull-down assays or bacterial two-hybrid systems

    • If nucleic acid binding is suspected, perform electrophoretic mobility shift assays

    • For RNA-binding proteins, conduct RNA immunoprecipitation followed by sequencing

  • Transcriptomic and proteomic analyses:

    • Compare gene expression profiles between wild-type and ΔyqhP strains

    • Use multiplexed ChIP-exo if DNA binding is suspected

    • Apply metabolomics to detect changes in metabolic pathways

How can I validate potential functions identified for YqhP?

Validation requires multiple lines of evidence:

  • Complementation studies:

    • Reintroduce yqhP into deletion strains to confirm phenotype reversal

    • Express yqhP under native and controlled promoters to assess dosage effects

  • Site-directed mutagenesis:

    • Mutate predicted functional residues (e.g., positively charged residues if nucleic acid binding is suspected)

    • Test mutant protein activity in vivo and in vitro

  • Heterologous expression:

    • Express yqhP in different bacterial species to test conservation of function

    • Examine whether orthologs from other species can complement B. subtilis ΔyqhP

  • Physiological relevance assessment:

    • Characterize the phenotype of ΔyqhP under various growth conditions

    • Measure growth parameters in different media compositions

    • Test stress responses including heat shock, nutrient limitation, and oxidative stress

How might bioinformatic approaches help predict YqhP function?

Implement a systematic bioinformatic workflow:

  • Sequence-based analysis:

    • Perform PSI-BLAST searches against multiple databases

    • Identify conserved domains using Pfam, SMART, and CDD

    • Analyze secondary structure prediction for functional motifs

  • Genomic context analysis:

    • Examine gene neighborhood conservation across bacterial species

    • Identify co-occurring genes that may participate in the same pathway

    • Apply phylogenetic profiling to identify functional associations

  • Structural prediction and analysis:

    • Use AlphaFold2 or RoseTTAFold to predict 3D structure

    • Compare predicted structure with experimentally determined structures of characterized proteins

    • Identify potential binding pockets or catalytic sites

  • Integration of multiple data types:

    • Apply machine learning approaches to predict function based on multiple features

    • Use STRING database to identify potential interaction partners

    • Consider transcriptomic data to identify co-expressed genes

How should experiments be designed to distinguish between direct and indirect effects of YqhP?

To establish causality in YqhP function:

What approaches can resolve contradictory data about YqhP function?

When facing conflicting results:

  • Standardize experimental conditions:

    • Ensure consistent growth media and conditions across experiments

    • Control for growth phase effects by synchronizing cultures

    • Document strain backgrounds precisely, as suppressor mutations are common in B. subtilis

  • Consider multiple functions:

    • Many bacterial proteins have moonlighting functions in different contexts

    • Test YqhP function under different physiological conditions

    • Examine subcellular localization under various conditions

  • Quantitative analysis:

    • Move beyond qualitative observations to quantitative measurements

    • Apply statistical methods appropriate for the specific data type

    • Perform power analysis to ensure sufficient sample size

  • Integrate multiple techniques:

    • Combine genetic, biochemical, and structural approaches

    • Validate key findings using methodologically distinct techniques

    • Design experiments that directly test competing hypotheses

What statistical approaches are appropriate for analyzing YqhP characterization data?

Select statistical methods based on your experimental design:

  • For transcriptomics/proteomics data:

    • Apply false discovery rate correction for multiple hypothesis testing

    • Use DESeq2 or limma for differential expression analysis

    • Implement GSEA or similar methods for pathway enrichment analysis

  • For growth/phenotype data:

    • Use mixed-effects models to account for batch variation

    • Apply non-parametric tests if normality assumptions are violated

    • Conduct time-series analysis for growth curve data

  • For structural data:

    • Implement clustering methods to identify structural similarities

    • Use molecular dynamics simulation statistics to assess stability

    • Apply statistical coupling analysis to identify co-evolving residues

  • For integration of multiple data types:

    • Use Bayesian networks to model causal relationships

    • Apply principal component analysis to reduce dimensionality

    • Employ machine learning approaches for classification and prediction

How can I determine if YqhP interacts with other cellular components?

Implement a stepwise interaction discovery process:

  • Initial screening:

    • Perform co-immunoprecipitation followed by mass spectrometry

    • Use bacterial two-hybrid systems for protein-protein interactions

    • Apply RIP-seq or CLIP-seq if RNA binding is suspected

  • Confirmation and characterization:

    • Validate key interactions with co-immunoprecipitation using specific antibodies

    • Determine binding affinities using surface plasmon resonance or microscale thermophoresis

    • Map interaction domains through truncation analysis

  • Functional relevance:

    • Assess whether interactions occur under physiologically relevant conditions

    • Determine if the interaction changes under stress conditions

    • Evaluate whether disrupting the interaction affects cellular function

  • Visualization:

    • Use fluorescence microscopy with fusion proteins to observe co-localization

    • Apply FRET or BRET to confirm proximity in living cells

    • Consider super-resolution microscopy for detailed localization studies

How should YqhP research findings be validated across different experimental systems?

Implement a comprehensive validation strategy:

  • Genetic background variation:

    • Test in multiple B. subtilis strains beyond the laboratory 168 strain

    • Consider natural isolates to evaluate ecological relevance

    • Examine effects in related Bacillus species

  • Expression level considerations:

    • Compare native expression to overexpression phenotypes

    • Use quantitative Western blotting to correlate protein levels with phenotypes

    • Implement tunable expression systems to determine threshold effects

  • Environmental conditions:

    • Validate findings across multiple growth media

    • Test under various stress conditions

    • Examine effects during different growth phases

  • Technical validation:

    • Employ different detection methods for key observations

    • Use complementary approaches (e.g., both in vivo and in vitro)

    • Replicate critical findings in independent laboratories

How might YqhP research contribute to our understanding of bacterial physiology?

YqhP characterization could advance bacterial biology in several ways:

  • Regulatory networks:

    • Uncover new regulatory mechanisms in B. subtilis

    • Identify previously unknown connections between pathways

    • Discover novel stress response mechanisms

  • Evolutionary insights:

    • Understand the evolutionary conservation of uncharacterized proteins

    • Identify bacterial adaptations to specific environmental niches

    • Discover novel protein domains with unique functions

  • Systems biology integration:

    • Complete missing links in metabolic or signaling networks

    • Improve predictive models of bacterial physiology

    • Identify new targets for synthetic biology applications

  • Methodological advances:

    • Develop new approaches for studying uncharacterized proteins

    • Establish pipelines for functional annotation

    • Create tools for integrating multiple data types in protein characterization

What are the challenges in translating YqhP findings to applications in biotechnology?

Consider these methodological challenges:

  • Scale-up considerations:

    • Determine if laboratory findings maintain relevance at production scales

    • Optimize expression conditions for consistent results

    • Address potential metabolic burden issues

  • Regulatory requirements:

    • Establish safety profiles for applications in various fields

    • Document strain stability over multiple generations

    • Characterize all potential byproducts or interactions

  • Production optimization:

    • Design expression systems with industrial relevance

    • Optimize culture conditions for maximal yield

    • Develop efficient downstream processing methods

  • Application-specific validation:

    • Test performance under conditions relevant to specific applications

    • Compare with existing solutions for benchmarking

    • Assess long-term stability and consistency

How can findings from YqhP research be integrated with studies of other uncharacterized proteins?

Implement a systematic integration approach:

  • Database development:

    • Contribute standardized data to protein function databases

    • Use consistent ontologies for functional annotation

    • Develop specialized databases for uncharacterized proteins

  • Network analysis:

    • Construct interaction networks incorporating newly characterized proteins

    • Identify functional modules containing multiple uncharacterized proteins

    • Apply graph theory to predict additional functional relationships

  • Comparative genomics:

    • Analyze co-occurrence patterns across bacterial species

    • Identify synteny in genomic organization

    • Study evolutionary patterns of conservation

  • Community engagement:

    • Establish collaborative projects focused on specific protein families

    • Develop shared resources and standardized protocols

    • Implement coordinated functional genomics approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.